VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

P97

Gene Name P97
Sequence Strain (Species/Organism) Mycoplasma hyopneumoniae 232
NCBI Gene ID 3105444
NCBI Protein GI 54020389
Locus Tag mhp183
Genbank Accession AE017332
Protein Accession YP_115696
Taxonomy ID 295358
Gene Starting Position 224079
Gene Ending Position 227405
Gene Strand (Orientation) -
Protein Name protein p97; cilium adhesin
Protein pI 9.5
Protein Weight 120335.63
Protein Length 1108
DNA Sequence
>NC_006360.1:224079-227405 Mycoplasma hyopneumoniae 232, complete genome
TTTATTTAGATTCTGGTTCCTGATTATTATTACTTTGTTTTACTGTTATTTTAACTTTTAGACTTGATTT
TTTAGGATCACCGGATTTTGAATCATCCCTTAGGATAAAGTATAGCAATTTAGCATCTCCAGCGATATTA
TCCTCGATTAGTTCAACCTCTGTTTTTCAATTTTTACCTTGTTTTTTAATGATTTCGTCAATTTTTTTAC
CTAAGTCAGGAAGGTAATTAGTTAATTCGGTAGTTGGGCTTTGTTGACTAGGTGCTCCCTCTGCTTTTTT
CCCTTGGTTAGGAGTTCCTTCGGCTTTTTTACCTTGGTTAGGCGCGCCTTCTGCTTTTTTACCTTGGTTA
GGAGTTCCTTCGCTTTTTTTACCTTGATTTGAAGATCCTTCGGTCATCATTGGGTGGCTAAGTTTCTGAT
ATTGGTCACTAGTTACCTTGACTTCCTGGAATTGATATTGAAGATTTAAAACAGTTTTATCTAGTTCCTT
TATTATTTCTTGTTCTTCATACTCGCTTTGATGAACTAGTTCTAAAAATACATTAATTTCCGGTGTTTTT
AGGCTTAATTTATTTTCGTCAGTATATTCTAATTTATAACTAAAAGCCATTGGGAAATAGTCTTCTTTTG
GTTTATTTGTAAGTGAAAAGCCAGTATTAGTAGCAACTGGTTTTGCTGCTTCTGGTTTAGCCGCTACTGG
TTTTGCTGCTTCTGGTTTAGCCGCTACTGGTTTTGCTGCTTCTGGTTTAGCCGCTACTGGTTTTGCTGCT
TCTGGTTTAGCCGCTACTGGTTTTGCTGCTTCAGGTTTAGCTGCTTCAGGTTTAGCTGCTACTGGTTTTG
TTGTTTCTGGTTTAGCCGCTACTGGTTTTGCTGCTTCTGGTTTTGCTGCTGGGGGCTGAGGCAATATACC
TTTTATTTTATTATCCAATTCCTTAACTTTTTTATCTACTTCTTCTCTTTTACCTTCTTTTGTAGTTTCC
CCTTTTTTGATAGCTTCAAATGAATACTGAAGATTATCGTCTAATTTTGCTCAAGGAGCAAAATTATTAA
ATTGGGCTGCTTTAAGGAAAAATGCTTTTAAAAAATCACCGAAGGTTTTAAAATCAGTCCCTTCAAGTAA
ATTTTTATCTAAAATAGTAGTTTTAAAAGCCGAGTTCTCAATTAAAGAATACTTTTTAAGCGCTTCAAAA
ATTTGCGCCTCATTTTTGCCTTCTAATTCAGTTTTTACACTTTGGGGCAATAATAAAACTCCGTAAAATC
CATCAGATTTTATTACATCGTTACGGGCTAAAATATTAAAGGAAAGTTGGTGAATTTCTTTTATCTGATT
GTAAGGATCCTTTTTCTTCAATTCCAAAAATTTTAATTTATCTGCTTCTGCAAAAATATCTTTTGTATAT
TGGAAAACCCCTTTTGGGAATTGTGCTCTGTTAGTTTCTAGTCCCCATTTTTTTGCTAGATCATAAAGAG
TCTCTAAAATTGTTAATTTGTCCTTGGTGAGTAAATCCTGGAAATAACTTGCAACTTGATGTCCATTTTT
AAAAAAGTTATTACTTTTAAGACTTGAAATTACTTGTTCTTTTGTTGTTTGTGGTTGATTTAAAACTGAA
TTAGAACCAATTTTAACTTGTTCTAAATGTCTTGTAAATCTTTGGATATCAGCTTTTTCAGGATGCTGAA
TTTTTCCTGTTCAGGAATTAAGCACGGATTTAAAGGCCCCGAATTCATAGGCATAATTTCCATCAAGTGC
TTGATAGATTTCTTGGTTTTTATTCCCTTTAAAAAGAGCTTCAACTTCAACTTTGGCAAGTTGAGTATTA
TATGGATTTAAGATATTACCATAGTCTAATTTTGCTTGTTCTTCTTTACCTTTTTCAAAAAATGGTAAAT
ATTCGGTTTTAAAAATTTGCTGATTGATATTAGGGAGATCAATTTTTGAGCCTTTTTTAAATCCAGTTAA
TTTAAGAATCCCTTCTTTTACGAGAATATTATCTTTTGTATCTGGATATAAATCATCGGCAAAAAATTTA
TCTTTAATTTCAAGGCGGTAGGGAATTAAAACTATTGATTTATCTTTTTTATCAAGACTTGCGCTTGCTG
CATCTAGGCTATATTCTAAATTTGGCGAGTTAAGACGGTCGTTGAATTTTCCATTGTATTTACCAAAGTC
ATAAATATTTTCTTTTTTATTTAAAAGATTACTAATTTCTGCCTTGGTATGACTGGATCTCTTGTCTCCA
GGGAAAAATCCAGATTTAATATCTGCTAGAAATTCATAGGCAGAAAGATTTTGACCCTTTGCATTTAAAT
CTTCTTTTTGCATATTTTTCAGTGTTAAATTATTAACAAAATCCTCAAAATTTAGAAAATAAGAAGAATT
ATCTTTTTTCATTAATCTTAAAATGTTAATAACTGGCTGAACTTCATCTGGGCTAGCTAAAATTTCACGG
GCACTTTGACTAAGATCTGCTTTTAAAAACAGCGAAGGAATTTGGTTCTGGATACTTACATATTGATTAG
TTGAACTATCTTTTGCAAAGCTAAATTCAAAAATATTACCCAAATTATTAGGTAATTTATTCTCAGGAGC
ATTATTTAGTCTGTTTATTAAATTTTTAAGTACTGGAAAATAATTAGCAAGCTTTATATCTAAATCCTCA
GGATTTCGCGCTGTATTTAAATCGTATTGGAAGTCAATAGCTCTTAGAGTTGAGGGATCTTTTTGGCTGC
TTGTTTTTTCATCAGCAAAATTTGTAATTTTTGTTGATAAATTTTCAATTTGTTGATTTAATTTTTCGGT
AATTTTTTTAAGCGAAAAATTAAATTCGGCAACTAAAAGATTTGACTGTTTGGCAAAAGCAACTGTTTGC
TCATAAATATCAGATTTGGCAATATCACCATTATGAAGTTTTTGTAATGCCTGAAATTTTACCTTAAAAT
TTTGATTGACATCATCAGGGATAATTTCAAGAATCTCAAAAGTTATCTTCGCCTTGGTATATTCAGGATC
TTGAAAATTAATTTTTTCTAACTGATCACCGTTTTTAGTAAAAAAGGAAAAGGAATCAATAACTTTTTCT
TTATTTCTAATATTGTTATTAGAATCAACTAGTCACCTTTTGACTATTTTATAATCAGAATCAGTCTCAA
AAGCATAAGGACTAAAAGCTAATGTTGAAACTTTTGCGGCAAAATCATTTGCAATCTTTCGTGGACTTTC
TGATCTGTATTTTGCCAAGCTGCTAAGTCCGACAGTTAGACCAAAAACTCCAAGACCAACAATTCCGGCA
GTCAAACCAATTTTAAATGTTTTTGATTTTTTACTCA

Protein Sequence
>YP_115696.1 protein p97; cilium adhesin [Mycoplasma hyopneumoniae 232]
MSKKSKTFKIGLTAGIVGLGVFGLTVGLSSLAKYRSESPRKIANDFAAKVSTLAFSPYAFETDSDYKIVK
RWLVDSNNNIRNKEKVIDSFSFFTKNGDQLEKINFQDPEYTKAKITFEILEIIPDDVNQNFKVKFQALQK
LHNGDIAKSDIYEQTVAFAKQSNLLVAEFNFSLKKITEKLNQQIENLSTKITNFADEKTSSQKDPSTLRA
IDFQYDLNTARNPEDLDIKLANYFPVLKNLINRLNNAPENKLPNNLGNIFEFSFAKDSSTNQYVSIQNQI
PSLFLKADLSQSAREILASPDEVQPVINILRLMKKDNSSYFLNFEDFVNNLTLKNMQKEDLNAKGQNLSA
YEFLADIKSGFFPGDKRSSHTKAEISNLLNKKENIYDFGKYNGKFNDRLNSPNLEYSLDAASASLDKKDK
SIVLIPYRLEIKDKFFADDLYPDTKDNILVKEGILKLTGFKKGSKIDLPNINQQIFKTEYLPFFEKGKEE
QAKLDYGNILNPYNTQLAKVEVEALFKGNKNQEIYQALDGNYAYEFGAFKSVLNSWTGKIQHPEKADIQR
FTRHLEQVKIGSNSVLNQPQTTKEQVISSLKSNNFFKNGHQVASYFQDLLTKDKLTILETLYDLAKKWGL
ETNRAQFPKGVFQYTKDIFAEADKLKFLELKKKDPYNQIKEIHQLSFNILARNDVIKSDGFYGVLLLPQS
VKTELEGKNEAQIFEALKKYSLIENSAFKTTILDKNLLEGTDFKTFGDFLKAFFLKAAQFNNFAPWAKLD
DNLQYSFEAIKKGETTKEGKREEVDKKVKELDNKIKGILPQPPAAKPEAAKPVAAKPETTKPVAAKPEAA
KPEAAKPVAAKPEAAKPVAAKPEAAKPVAAKPEAAKPVAAKPEAAKPVATNTGFSLTNKPKEDYFPMAFS
YKLEYTDENKLSLKTPEINVFLELVHQSEYEEQEIIKELDKTVLNLQYQFQEVKVTSDQYQKLSHPMMTE
GSSNQGKKSEGTPNQGKKAEGAPNQGKKAEGTPNQGKKAEGAPSQQSPTTELTNYLPDLGKKIDEIIKKQ
GKNWKTEVELIEDNIAGDAKLLYFILRDDSKSGDPKKSSLKVKITVKQSNNNQEPESK

Molecule Role Protective antigen
Molecule Role Annotation a P97 recombinant replication-defective adenovirus (rAdP97c) subunit vaccine efficiency was evaluated in pigs. The rAdP97c vaccine was found to induce both strong P97 specific humoral and cellular immune responses. The rAdP97c vaccinated pigs developed a lower amount of macroscopic lung lesions (18.5 + or - 9.6%) compared to the unvaccinated and challenged animals (45.8 + or - 11.5%). rAdP97c vaccine reduced significantly the severity of inflammatory response and the amount of M. hyopneumoniae in the respiratory tract. The challenge was performed at day 28 after the first vaccination with 106 CCU of the 232 M. hyopneumoniae strain by intratracheal route (Okamba et al., 2010).
Related Vaccines(s) rAd-P97c
References