VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

B. melitensis M5 P39

Gene Name B. melitensis M5 P39
Sequence Strain (Species/Organism) B. melitensis strain M5
VO ID VO_0010948
NCBI Protein GI 122892474
Genbank Accession EF189139
Protein Accession ABM67295
Other Database IDs CDD:224567
CDD:304360
Taxonomy ID 1004957
Gene Strand (Orientation) ?
Protein Name immunogenic 39-kDa protein
Protein pI 4.69
Protein Weight 40682.69
Protein Length 483
Protein Note biovar: 1 str. M5
DNA Sequence
>gi|122892473|gb|EF189139.1| Brucella melitensis strain M5 immunogenic 39-kDa protein gene, complete cds
ATGGGTACGGCTTCCTGTGGTTTGCTCGCCGGAATGGCGCCTGTTGCCAATGCGCAGGAAAAGCAGAATG
TCGAGGTTCTGCACTGGTGGACGTCCGGCGGCGAAGCGTCCGCGCTTGAAGTTTTGAAAAAAGATCTTGA
AAGCAAGGGCATTAGCTGGACCGATATGCCGGTTGCAGGTGGCGGCGGCACGGAAGCCATGACCGTTTTG
CGCGCGCGCGTTACCGCAGGCAATGCGCCAACCGCGGTGCAGATGCTGGGTTTTGACATTCGCGACTGGG
CGGAGCAGGGCGCACTCGGCAATCTCGATACGGTTGCTTCCAAGGAAGGCTGGGAAAAGGTTATTCCGGC
TCCCTTGCAGGAATTTGCCAAATATGACGGCCACTGGATTGCTGCGCCCGTCAATATTCACTCCACCAAC
TGGATGTGGATCAACAAGGCTGCTCTCGACAAGGCTGGCGGCAAGGAGCCGACCAATTGGGATGAGCTGA
TTGCGCTTCTCGACAATTTCAAGGCGCAGGGCATTACGCCGATCGCGCATGGCGGCCAGCCGTGGCAGGA
TGCAACCATTTTCGATGCGGTTGTTCTTTCATTCGGCCCGGATTTCTACAAGAAGGCCTTCATCGATCTC
GACCCGGAAGCACTGGGCAGCGATACCATGAAGCAGGCCTTCGACCGCATGTCCAAGCTTCGCACCTATG
TTGATGACAACTTCTCCGGCCGTGACTGGAACCTTGCTTCGGCCATGGTTATCGAAGGCAAGGCCGGTGT
CCAGTTCATGGGCGACTGGGCGAAGGGCGAGTTCCTCAAGGCGGGCAAGAAGCCGGGTGAGGATTTCGTC
TGCATGCGTTATCCGGGCACGCAGGGTGCTGTCACTTTCAATTCCGGCATGTTCGCCATGTTCAAGGTTT
CGGAAGACAAGGTTCCCGCACAGCTTGAAATGGCTTCGGCGATTGAAAGCCCTGCCTTCCAGTCTGCCTT
TAATGTGGAGAAGGGGTCGGCCCCGGCACGCACGGATGTGCCCGATACCGCTTTCGATGCCTGTGGCAAG
AAGACCATTGCCGATGTCAAGGAAGCAAACAGCAAGGGCACTCTGCTTGGCTCCATGGCGCATGGCTATG
CCAATCCGGCTGCCGTGAAGAATGCGATCTACGACGTCGTGACCCGCCAGTTCAACGGCCAGCTTTCTTC
GGAAGATGCCGTCAAGGAACTCGTTGTGGCGGTTGAAGCCGCAAAATAAGGCCACGCGGAAACGTCCGGG
GGAACCTCCCGGACGTTTTTCCTGCGTGCTCCAGCAGAAGCGCATAGGCGGTTGGCGCAGCTAACCGGCA
CTTACGACGGAATTGCATGCCGATATGCCCGCCTCACCATCCGAGGCGCGTTTCGTGGGACATAGAGC
Protein Sequence
>ABM67295.1 immunogenic 39-kDa protein [Brucella melitensis bv. 1 str. M5]
MAPVANAQEKQNVEVLHWWTSGGEASALEVLKKDLESKGISWTDMPVAGGGGTEAMTVLRARVTAGNAPT
AVQMLGFDIRDWAEQGALGNLDTVASKEGWEKVIPAPLQEFAKYDGHWIAAPVNIHSTNWMWINKAALDK
AGGKEPTNWDELIALLDNFKAQGITPIAHGGQPWQDATIFDAVVLSFGPDFYKKAFIDLDPEALGSDTMK
QAFDRMSKLRTYVDDNFSGRDWNLASAMVIEGKAGVQFMGDWAKGEFLKAGKKPGEDFVCMRYPGTQGAV
TFNSGMFAMFKVSEDKVPAQLEMASAIESPAFQSAFNVEKGSAPARTDVPDTAFDACGKKTIADVKEANS
KGTLLGSMAHGYANPAAVKNAIYDVVTRQFNGQLSSEDAVKELVVAVEAAK

Molecule Role Protective antigen
Molecule Role Annotation The 39-kDa protein is immunogenic.
Related Vaccines(s) B. melitensis P39 protein vaccine
References