VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

IL6

Gene Name IL6
Sequence Strain (Species/Organism) Homo sapiens
NCBI Gene ID 3569
NCBI Protein GI 10834984
Genbank Accession AC073072
Protein Accession NP_000591
Taxonomy ID 9606
Chromosome No 7
Gene Starting Position 22766765
Gene Ending Position 22771620
Gene Strand (Orientation) +
Protein Name interleukin 6 (interferon, beta 2)
Protein pI 6.52
Protein Weight 22923.52
Protein Length 212
Protein Note Also known as HGF; HSF; BSF2; IL-6; IFNB2
DNA Sequence
>gi|224589819:22766765-22771620 Homo sapiens chromosome 7, GRCh37.p5 Primary Assembly
CAATATTAGAGTCTCAACCCCCAATAAATATAGGACTGGAGATGTCTGAGGCTCATTCTGCCCTCGAGCC
CACCGGGAACGAAAGAGAAGCTCTATCTCCCCTCCAGGAGCCCAGCTATGAACTCCTTCTCCACAAGTAA
GTGCAGGAAATCCTTAGCCCTGGAACTGCCAGCGGCGGTCGAGCCCTGTGTGAGGGAGGGGTGTGTGGCC
CAGGGAGGGCTGGCGGGCGGCCAGCAGCAGAGGCAGGCTCCCAGCTGTGCTGTCAGCTCACCCCTGCGCT
CGCTCCCCTCCGGCACAGGCGCCTTCGGTCCAGTTGCCTTCTCCCTGGGGCTGCTCCTGGTGTTGCCTGC
TGCCTTCCCTGCCCCAGTACCCCCAGGAGAAGATTCCAAAGATGTAGCCGCCCCACACAGACAGCCACTC
ACCTCTTCAGAACGAATTGACAAACAAATTCGGTACATCCTCGACGGCATCTCAGCCCTGAGAAAGGAGG
TGGGTAGGCTTGGCGATGGGGTTGAAGGGCCCGGTGCGCATGCGTTCCCCTTGCCCCTGCGTGTGGCCGG
GGGCTGCCTGCATTAGGAGGTCTTTGCTGGGTTCTAGAGCACTGTAGATTTGAGGCCAACGGGGCCGACT
AGACTGACTTCTGTATTTATCCTTTGCTGGTGTCAGGAAGTTCCTTTCCTTTCTGGAAAATGCAGAATGG
GTCTGAAATCCATGCCCACCTTTGGCATGAGCTGAGGGTTATTGCTTCTCAGGGCTTCCTTTTCCCTTTC
CAAAAAATTAGGTCTGTGAAGCTCCTTTTTGTCCCCCGGGCTTTGGAAGGACTAGAAAAGTGCCACCTGA
AAGGCATGTTCAGCTTCTCAGAGCAGTTGCAGTACTTTTTGGTTATGTAAACTCAATGGCTAGGATTCCT
CAAAGCCATTCCAGCTAAGATTCATACCTCAGAGCCCACCAAAGTGGCAAATCATAAATAGGTTAAAGCA
TCTCCCCACTTTCAATGCAAGGTATTTTGGTCCTGTTTGGTAGAAAGAAAAGAACACAGGAGGGGAGATT
GGGAGCCCACACTCGAATTCTGGTTCTGCCAAACCAGCCTTGTGATCTTGGGTAAATTCCCTACCACCTC
TGGACTCCATCAGTAAAATTGGGCGTGGACTAGGTGATCTCATAGATCCTTCCTGCTGGAACATTCTATG
GCTTGAATTATATTCTCCTAATTATTGTCAAAATTGCTGTTATTAAGTATCTACTGTGTGCCAGGCACTT
TAAATAAATATTGTGTCTAATCTTCAAAACAAATTTGCAAGGAAGGTTTTTGGAGATAAGGAAACTGAGA
CTCAGGATTAAGTAACACACCTAAAGTCACAGGTGAGCTTGGAACTGAACCCAAGTGTGCCCCCACTCCA
CTGGAATTTGCTTGCCAGGATGCCAATGAGTTGTAGCTTCATTTTTCTTAGAGACTTTCCTGGCTGTGGT
TGAACAATGAAAAGGCCCTCTAGTGGTGTTTGTTTTAGGGACACTTAGGTGATAACAATTCTGGTATTCT
TTCCCAGACATGTAACAAGAGTAACATGTGTGAAAGCAGCAAAGAGGCACTGGCAGAAAACAACCTGAAC
CTTCCAAAGATGGCTGAAAAAGATGGATGCTTCCAATCTGGATTCAATGAGGTACCAACTTGTCGCACTC
ACTTTTCACTATTCCTTAGGCAAAACTTCTCCCTCTTGCATGCAGTGCCTGTATACATATAGATCCAGGC
AGCAACAAAAAGTGGGTAAATGTAAAGAATGTTATGTAAATTTCATGAGGAGGCCAACTTCAAGCTTTTT
TAAAGGCAGTTTATTCTTGGACAGGTATGGCCAGAGATGGTGCCACTGTGGTGAGATTTTAACAACTGTC
AAATGTTTAAAACTCCCACAGGTTTAATTAGTTCATCCTGGGAAAGGTACTCTCAGGGCCTTTTCCCTCT
CTGGCTGCCCCTGGCAGGGTCCAGGTCTGCCCTCCCTCCCTGCCCAGCTCATTCTCCACAGTGAGATAAC
CTGCACTGTCTTCTGATTATTTTATAAAAGGAGGTTCCAGCCCAGCATTAACAAGGGCAAGAGTGCAGGA
AGAACATCAAGGGGGACAATCAGAGAAGGATCCCCATTGCCACATTCTAGCATCTGTTGGGCTTTGGATA
AAACTAATTACATGGGGCCTCTGATTGTCCAGTTATTTAAAATGGTGCTGTCCAATGTCCCAAAACATGC
TGCCTAAGAGGTACTTGAAGTTCTCTAGAGGAGCAGAGGGAAAAGATGTCGAACTGTGGCAATTTTAACT
TTTCAAATTGATTCTATCTCCTGGCGATAACCAATTTTCCCACCATCTTTCCTCTTAGGAGACTTGCCTG
GTGAAAATCATCACTGGTCTTTTGGAGTTTGAGGTATACCTAGAGTACCTCCAGAACAGATTTGAGAGTA
GTGAGGAACAAGCCAGAGCTGTGCAGATGAGTACAAAAGTCCTGATCCAGTTCCTGCAGAAAAAGGTGGG
TGTGTCCTCATTCCCTCAACTTGGTGTGGGGGAAGACAGGCTCAAAGACAGTGTCCTGGACAACTCAGGG
ATGCAATGCCACTTCCAAAAGAGAAGGCTACACGTAAACAAAAGAGTCTGAGAAATAGTTTCTGATTGTT
ATTGTTAAATCTTTTTTTGTTTGTTTGGTTGGTTGGCTCTCTTCTGCAAAGGACATCAATAACTGTATTT
TAAACTATATATTAACTGAGGTGGATTTTAACATCAATTTTTAATAGTGCAAGAGATTTAAAACCAAAGG
CGGGGGGGCGGGCAGAAAAAAGTGCATCCAACTCCAGCCAGTGATCCACAGAAACAAAGACCAAGGAGCA
CAAAATGATTTTAAGATTTTAGTCATTGCCAAGTGACATTCTTCTCACTGTGGTTGTTTCAATTCTTTTT
CCTACCTTTTACCAGAGAGTTAGTTCAGAGAAATGGTCAGAGACTCAAGGGTGGAAAGAGGTACCAAAGG
CTTTGGCCACCAGTAGCTGGCTATTCAGACAGCAGGGAGTAGACTTGCTGGCTAGCATGTGGAGGAGCCA
AAGCTCAATAAGAAGGGGCCTAGAATGAAACCCTTGGTGCTGATCCTGCCTCTGCCATTTCTACTTAAGC
CAGGGTTTCTCATATGTTAACATGCATGGGAATTCCCTGGGCATCTTCTTGTGGTGTGGAGTCTGACTTA
GCAAGCCTCGGGTGGGTTTGAGGGTCAAATTTCTACCAGGCTTATATCCCTGGTGATGCTGCAGAATTCC
AGGACCACACTTGGAGGTTTAAGGCCTTCCACAAGTTACTTATCCCATATGGTGGGTCTATGGAAAGGTG
TTTCCCAGTCCTCTTTACACCACCGGATCAGTGGTCTTTCAACAGATCCTAAAGGGATGGTGAGAGGGAA
ACTGGAGAAAAGTATCAGATTTAGAGGCCACTGAAGAACCCATATTAAAATGCCTTTAAGTATGGGCTCT
TCATTCATATACTAAATATGAACTATGTGCCAGGCATTATTTCATATGACAGAATACAAACAAATAAGAT
AGTGATGCTGGTCAGGCTTGGTGGCTCATGCCTGTATTCCCTAAACTTTGGGAGCCTAAGGTGAGAACTC
CTTGAACTCCTAAGGCCAGGAGTTCAAGACCAGCCTGGATAACATAGCAAGACCCCATCTCTACAAAAAA
CCAAAACCAAACAAACAAAAATGATAGTGGTGCTTCCCTCAGGATGCTTGTGGTCTAATGGGAGACAGAA
CAGCAAAGGGATGATTAGAAGTTGGTTGCTGTGAGCCAGGCACAGTGCTGATATAATCCCAGCGCTATGG
GAGGCTGAGGTGGGTGGATCATTTGAGGCCAGGAGTTTAAGACCAGCCTGGTCAACATGGTAAAACCCCA
TCTCTACTTAAAAATACAAAAAAGTTAGCCAGGCATGGTGGCATACACCTGTAACCCAGCTACTCAGGAG
GCTGAGGCACATGAATCACTTGAACCCAGGAGGCAGAGGTTGCTGTGCACCACTGCACTCCAGCCTGGGT
GACAGAACGAGACCTTGACTCAAAAAAAAAAAAAAGAAGTTTGTTGCTATGGAAGGGTCCTACTCAGAGC
AGGCACCCCAGTTAATCTCATTCACCCCACATTTCACATTTGAACATCATCCCATAGCCCAGAGCATCCC
TCCACTGCAAAGGATTTATTCAACATTTAAACAATCCTTTTTACTTTCATTTTCCTTCAGGCAAAGAATC
TAGATGCAATAACCACCCCTGACCCAACCACAAATGCCAGCCTGCTGACGAAGCTGCAGGCACAGAACCA
GTGGCTGCAGGACATGACAACTCATCTCATTCTGCGCAGCTTTAAGGAGTTCCTGCAGTCCAGCCTGAGG
GCTCTTCGGCAAATGTAGCATGGGCACCTCAGATTGTTGTTGTTAATGGGCATTCCTTCTTCTGGTCAGA
AACCTGTCCACTGGGCACAGAACTTATGTTGTTCTCTATGGAGAACTAAAAGTATGAGCGTTAGGACACT
ATTTTAATTATTTTTAATTTATTAATATTTAAATATGTGAAGCTGAGTTAATTTATGTAAGTCATATTTA
TATTTTTAAGAAGTACCACTTGAAACATTTTATGTATTAGTTTTGAAATAATAATGGAAAGTGGCTATGC
AGTTTGAATATCCTTTGTTTCAGAGCCAGATCATTTCTTGGAAAGTGTAGGCTTACCTCAAATAAATGGC
TAACTTATACATATTTTTAAAGAAATATTTATATTGTATTTATATAATGTATAAATGGTTTTTATACCAA
TAAATGGCATTTTAAAAAATTCAGCA
Protein Sequence
>gi|10834984|ref|NP_000591.1| interleukin-6 precursor [Homo sapiens]
MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKE
TCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQA
RAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALR
QM
Related Vaccines(s) 2008–2009 trivalent influenza vaccine , Bacille Calmette-Guérin (BCG) , FluMist
References