VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

ORF

Gene Name ORF
VO ID VO_0010927
NCBI Nucleotide GI 599653
NCBI Protein GI 599654
Protein Accession CAA86936.1
3D structure: PDB ID 1DI0
Other Database IDs CDD:237096
CDD:187741
GOA:P61711
InterPro: IPR002180
PDB: 1DI0
PDB: 1T13
PDB: 1XN1
UniProtKB/UniProt: P61711
Taxonomy ID 235
Gene Strand (Orientation) ?
Protein pI 7.41
Protein Weight 16119.15
Protein Length 197
Protein Note riboflavin synthase subunit beta; Provisional
DNA Sequence
>gi|599653|emb|Z46864.1| B.abortus gene for open reading frame
GAATTCCGATCAGTGCATAGTTTCCGCGTGCTCGCGCAATGGTGCGCGGGCTTGTTCTCGGGGCGGGGTG
AAACTCCCCACCGGCGGTATGAAAAGCAATTTTCAAGCCCGCGAGCGCCTGAAATGGAAGCCGATTCGCA
TGCCATTTCAGGGTCAGCAGATCCGGTGAGATGCCGGAGCCGACGGTTAAAGTCCGGATGGAAGAGAGCG
AATGAGCGTCACGATTGCGCCTTCCGGCGTCGTTCTTGCGTTCTTTTGTGCGCCCTGATTCTAGTTTCGT
GAGGAACCTATGAACCAAAGCTGTCCGAACAAGACATCCTTTAAAATCGCATTCATTCAGGCCCGCTGGC
ACGCCGACATCGTTGACGAAGCGCGCAAAAGCTTTGTCGCCGAACTGGCCGCAAAGACGGGTGGCAGCGT
CGAGGTAGAGATATTCGACGTGCCGGGTGCATATGAAATTCCCCTTCACGCCAAGACATTGGCCAGAACC
GGGCGCTATGCAGCCATCGTCGGTGCGGCCTTCGTGATCGACGGCGGCATCTATCGTCATGATTTCGTGG
CGACGGCCGTTATCAACGGCATGATGCAGGTGCAGCTTGAAACGGAAGTGCCGGTGCTGAGCGTCGTGCT
GACGCCGCACCATTTCCATGAAAGCAAGGAGCATCACGACTTCTTCCATGCTCATTTCAAGGTGAAGGGC
GTGGAAGCGGCCCATGCCGCCTTGCAGATCGTGAGCGAGCGCAGCCGCATCGCCGCGCTTGTCTGACTAA
CCCTCTATAATACGCCCGCAATGGGTATAAATGTCGAATTC
Protein Sequence
>CAA86936.1 ORF [Brucella abortus]
MNQSCPNKTSFKIAFIQARWHADIVDEARKSFVAELAAKTGGSVEVEIFDVPGAYEIPLHAKTLARTGRY
AAIVGAAFVIDGGIYRHDFVATAVINGMMQVQLETEVPVLSVVLTPHHFHESKEHHDFFHAHFKVKGVEA
AHAALQIVSERSRIAALV

Molecule Role Protective antigen
Molecule Role Annotation This gene was originally isolated from a lambda gt11 expression library probed with sera from Brucella-infected sheep. Sequence analysis of the cloned gene revealed the presence of an open reading frame of 158 amino acids encoding a protein of 17.3 kDa (Hemmen et al., 1995). It was later identified as a cytoplasmic protein lumazine synthase (Goldbaum et al., 1999). This gene can be used for diagnosis (Hemmen et al., 1995; Goldbaum et al., 1999) and vaccine development (Velikovsky et al., 2002).
Related Vaccines(s) B. abortus pcDNA-BLS , B. melitensis DNA vaccine pCIBLSOmp31 encoding BLSOmp31 (fusion protein)
References