VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

B. abortus strain 19 L7/L12

Gene Name B. abortus strain 19 L7/L12
Sequence Strain (Species/Organism) Strain 19
VO ID VO_0010928
NCBI Protein GI 304271
Genbank Accession L19101
Other Database IDs CDD:234671
CDD:100102
Taxonomy ID 235
Gene Strand (Orientation) ?
Protein Name ribosomal protein L7/L12
Protein pI 4.49
Protein Weight 11795.56
Protein Length 183
Protein Note biovar Abortus
DNA Sequence
>gi|304270|gb|L19101.1|BRURPL712X Brucella abortus ribosomal protein L7/L12 gene, complete cds 
CAAGCTCGTTATTCTCGGTGGCGCAATGGGTGCAACGACGCTTAGACCGATGGCGTCAAGTCGCTTCGTT
CGCTCCCGTCGCTCGACGAACTGCGCGCAAAGCTGGTTGGTATGATCCAGACCCCGGCTCAGCGTCTTGC
AGTGCTTACCAGCGCTCCGCGGGCCAGATCGCCCGCGTTATTGCGCGCACGCCCGGAAGAACGAGGCGGC
TTAAGGCCGTTTCTCGCTGTCAACAGTTCAAACCTTAATTATAGGAAATACAAAAATGGCTGATCTCGCA
AAGATCGTTGAAGACCTTTCGGCCCTGACCGTTCTGGAAGCCGCTGAGCTGTCCAAGCTTCTCGAAGAGA
AGTGGGGCGTTTCGGCTGCTGCTCCGGTCGCTGTTGCTGCTGCCGGTGGCGCTGCCCCTGCTGCTGCCGC
AGAAGAAAAGACCGAATTCGACGTCGTTCTCGCTGACGGCGGCGCTAACAAGATCAACGTGATCAAGGAA
GTGCGCGCACTCACCGGTCTCGGCCTCAAGGAAGCCAAGGACCTGGTCGAAGGCGCTCCGAAGGCTGTCA
AGGAAGGCGCCTCGAAGGACGAAGCTGAGAAGATCAAGGCACAGCTCGAAGCTGCTGGCGCCAAGGTTGA
ACTCAAGTAAGTTTGGACTATT
Protein Sequence
>AAA19863.1 ribosomal protein L7/L12 [Brucella abortus]
MADLAKIVEDLSALTVLEAAELSKLLEEKWGVSAAAPVAVAAAGGAAPAAAAEEKTEFDVVLADGGANKI
NVIKEVRALTGLGLKEAKDLVEGAPKAVKEGASKDEAEKIKAQLEAAGAKVELK

Molecule Role Protective antigen
Related Vaccines(s) B. abortus DNA vaccine expressing BCSP31, SOD and L7/L12 , B. abortus DNA vaccine pcDNA3.1-p39-L7/L12 encoding p39-L7/L12 fusion protein , B. abortus subunit vaccine using L7/L12
References