VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Cxcl9

Gene Name Cxcl9
Sequence Strain (Species/Organism) Mus musculus
NCBI Gene ID 17329
NCBI Protein GI 110626107
Genbank Accession AC109603
Protein Accession NP_032625
Taxonomy ID 10090
Chromosome No 5
Gene Starting Position 92321330
Gene Ending Position 92328078
Gene Strand (Orientation) -
Protein Name chemokine (C-X-C motif) ligand 9
Protein pI 11.28
Protein Weight 14046.52
Protein Length 126
Protein Note Also known as CMK; Mig; MuMIG; Scyb9; crg-10; BB139920
DNA Sequence
>gi|372099105:92321330-92328078 Mus musculus strain C57BL/6J chromosome 5, GRCm38 C57BL/6J
AGACATTGAAAAACATGTTTATTTTGGAATTTAGTGCACTTTTACTGATATCACTACGCTTTCACGAAAT
AGCTTCAGAGCACATATGCTAATTTGCTTTGAATTAAAAATTAGAGTACACATATGAAGTCATACTGTAG
GCATATGCATCCAACATAACTATTTAGTAAAAATTACACAGGCTTTGGCTAGTCGTTATGCATACTACCC
AGCTGTCAGATGCAAGGGTAGCTAACTAGTTAGGAAACAATTTTAGACTTTTTTTTTTTTTTTCCAAAGT
AAATTACCGAAGGGAGGTGGACAACGTTTTGACTGTGCAATGTTGTTTGGATGGGAGTCCCACCAGCAGC
ACAAAAACCACCTGCATGCAGCGCCAGGAATGGCAGTATTTGAGAAAAAGCATGCTCAAGACGGAACTTC
TGCCCAGAGACATTCTTTTCTATCTAATTCATCAGACCTCCTCTCTAGAGCAGTTTCCAGCTCCCACACA
GGCTAACTTGGCCCTGTCCACACTTCCACTCGCAGAATTTACTGCTTCCTGTAGCTCTTAATTCCTTTAA
AAATATCTCTGTAAAGATTTTTATTTGCCGTCTGAGATTATGGGTGTATGTCATGGGGGCCTGTGTACAC
CTGTGCAATGCTTGCAGAGGCCAGAAGAGAGAAATGGGTTCCCTGGAGCTGGAGTCACAGGTGGCCACAA
GGCTCACGCACACGTGGGGGTGGGTGCTGGGAATGGAACTCTGGCTCCCTCTCCAGCCCTGATCTTTCCA
TTTCACCACTCCTAGCCTGATGTGGCAATCCATACAATCATACACTGGGATTTCTGCAATGAGGGAGGGA
AGGTGGCAAGGAAATTCATATTCACCTAAGATAAACTTGCTAAAGGATTTGGCAGCTCTTTTGTTGACTC
CTAGGGAGCTTGTCCTGATCAAGAATGATATTAGAGGAATTTTGTTTTGAGTGAGGAAAGATCTAGTATT
TGCCAATCAGTCAAACCTGTCTTCCATGTAAGCTTATGTTTCTAGATGGCCTGTGTAATTTTTCCTGAGC
AGTCCCAAATATCCGCAAATGTCTTGAACATGTGATTCCTGTTTGTTAAAGACACGAGCCTCCTGTCACA
AGGTAAGGCTCTTTTTCACCCTGTCTGGCTCTGTGCGCTGAAGATGTCTGAAGATAATAAGAAAGCTAGA
TAATTTAAGGAAGGAAGGAAGGAAGGAAGGAAGGAAGGAAGGAAGGAAGGAAGGAAGGAAGGGAGGGAGG
GAGAAAGGAAGGAAGGCAGGCAATCAGGTGTAGTAGCACACACCTTTAACCCCAGCATTCAGGAGGCAGT
AGAATACAGATATGTATGAATTTGAGACCAGCCTTGTCTACTTTGAGAGTTTTAGGACAGCCAGATATAA
AACTTTCTTTAAAAAAAAAAAAAAAAAGTGGTAAGCAAGCAAGGAGGCCAAAGGTTAGTTAGGCAATTTG
GAGCAGCCGGGGATTGGCCAATGCCTGGTGTGTAACAGCCTTTCTACCTCTCACACATACAATTAGGAAA
TTATTCAAAACCAAGTTTTTGTAGGCACTGTGGAAGATTTAGGGGAATAGTCTGTGGTCCCTACTCTTAA
AAACCCGTCTCGTTGGAAAAAGTAAAACAAACAAACAAACAAATCCAATTAGATAGCAGCGAAGTGTTTA
CTTGTGAAACAGGAATAAATTTAAGAGAATTTGAGTAGCCAGAAAATGTTCTTTAAATTGGTTAAGTTTT
TGCACTGTTAGTGAAGGACCTGGTCCCTGCAACACCAAGTGTTCTGCCACTAAGCTACAGCCACAACCTT
CTAGGAGAGTTTTATTGAAGAGGCAAACTTAGAATAAGCTCTGAAGATGGGATCAAGTTAATAATGAAAT
CCCATGGTCTCGAAAGCTACGTGGGAGGTTCTGAAGGCCAACTCTGGTGGTCTCCACTGTAGAACCCCAA
AACCATTAGCACCATCTCTGAGACACAATGTGTGCAGGGGCTCTAGGCTGACCCAAATGCAGCTGCCGAG
GGCCTCTCCAGCTTGGTGAGGTCTATCTAGCTCACCAGCAAACAGACAGGCCTGGGATTTGGTGACGTGA
GCCTCAGAAGTCTTCGGAGGCTGCCAAATGTGTGGCTCTGGAAGCCAGACAGCTGTTGTGCATTGGATAG
CTATGAAGGAAAGGGACACTTGCCCAGATCTGATGTTATCACGACTAGGCTCAAGGGCGTGATGAAATTT
TGTTGGCTGTGTAGAACACAGAGTTTTTGCCTCTAGCAATTGTTACTATTGGAGTTTTGCAATTAACTTC
CTAAAGTTAGTTATAATTTCAAATTAACACTTTATGTTTTGTAGTTGAGTTAATGTATTAAAAGCCTATG
TATTAAAGGCTGCTCTGCCAGGGAAGGCTTTTCAGTACAATCTAAAACCCATTAAGATTCAGGGTGCTTG
TTGGTAAAGTAATGGTCTCTTATGTAGTCTTCCTTGAACGACGACGACTTTGGGGTGTTTTGGGTTTTCT
GTTTTTCATGTTCTTTTGATGTTTTTTCCCCCTCTTTTGCTTTTTCTTTTGGCTGATCTGCAAGAAATGA
GAAAAAGGCAATGCTTTCCAATGTTGTAGTTTCTCCCCTTCGAGATGGTCCAACTCCTGAGTGTGATCTC
TCCTTATCCTCAGAGCCAGCTCACGTCGCTGCTCTCTCAGAGGCGCTGGCCTCATTATCTGCTGCCCCTA
CATTAAAGAAGCTACAGTTCCCTCTTTGCTTGTTTGTCTGTTTTCTGGCATCTTGCTGTCTTTCATCTTC
TCCCTTCATCTCCCACCTGGGCCAAACACAGCCCTTTGGGGCTGGCTGGTAGCGTTATCACTCACTTTGC
ATATTAGCCAGTGGTTCTCAACTTGTATGTCGAAACCCATTCGGGGGCACATAGCAGATATCCTGTGTCT
CAAGTATTTACATTATGATTGTTAACAGTAGCAAACATTACAGTTATGAAGTAGCAGTAAGATAACTTTA
TGGTTGGGGGTCACCTCAATATGAGGGACTCATGCATTAGGGTCTCAGCATTAGGAAGGTTGAGAACCAC
TGAAACTGGACAAGGCTAGGCGAGTGAGTAGCCTGAAGCTTAAGGGCTAGGGTCTAGGGCAGACCCAGCA
GTTAGGTGTGGGGACCCAAGCTCCCCACCACATACCCCATGGCTCTTCTCAAACCCAGCTCCTTAGCTAT
CTCACAGCTCTTTTCCCTTTTTCCTTGGCTCCTTTCTCATCTCAATCCCTTTGTTCTCTGCATTTAAATT
CCAGTTACATTACTTCAGACTCACTGAACAGACTTTACTCAAAACCACCAACGCCCACACTGTACTTAAT
TAACTGCCTGGTAAATGTCTTATCCTCAAAGATCCAGATCAGAGATCACTTGATAGGAGAAGTCTACCTT
AATACTTTCTATATTGTCTCTTGGTCAAGTCAATTACCCTTTCCATCATAATTCTCAAAGTTCTCATGTA
CACACTATTTATTCTAAATGTCTCTCACCACGTCTGTTGATTTTTATACATTGTTAATGACTATCTGCTA
TATGGGGGAGGGGTGATAGCTTATTAATTTTGAATCCTTAGTGTCTTACTAGTTGATGCTATTCAAAAGG
ATGGAAAATGGGTCCTTAATGGGTGTGCCCAGGATCTGCTGACTTTGTGAGCTGACCTCTGAAAGAAAGC
CATTTGGGTTCCTCCCCCACCAACCTTCTTTTCCCATTCTTTCATCAGCTTCTTCACATTTGCCGAGTCC
GGATCTAGGCAGGTTTGATCTCCGTTCTTCAGTGTAGCACTGTGCCAAAGAAACACCAGTGAGCTTTCTC
CCCCCAGTAACAACTTCATAATTCTTAGTAGAAACAGTGGAGGAAAACGTGCATTTTATTGAGTTTTCCA
GTGAAACCACTTAAAATGTGGCAAAACGTCTTCCTAAGATTAACAGGTATATTTTTAAAAACTGTAGCAG
ATTTTTCAGGAGAAACCTCAATTTCTAAAAATTAATTTCTCTGTATAGCTTGAGAATAATAATGGCTATT
CTATATAGAATTCCTTATTTTAGTTGTCAAAGGTCAAATATATTACATACATGTATGTATATATATATTT
ATATCCTTTATATATGTATGTGTATATATTTATATCCTTTATATCGTATACATACATACACACATATAAA
TATATTATATAATATTATATATCCTTTAATTTCATAGTTCTGATTTCTAAGAGGCTTGGAATGGTGGTTT
ATTCCTGGAATCCCAGCATTCACGTGGACTGAAGTCAGCCTTGGCTACCTAGCAAGACTCTGTCTCAAAA
CAAAACAAACACGAAATTCTAGTCTCTAGAAAAGAATTACTAGGAAAGAATTAAACACAATCCTACAACA
GTAATAGTCTGACAACAGTGAATTTTTTTTAAACATAACCGTTGTTTCTAGCAATGGGCCATGTGCTATA
CAAATTATGGCTTATCAATATGATGTAAAACAGCTTAGCCATCAAAAGTCATTATTAGGCCAGGGAGTTG
ATGTGACTGCTAAGCATACTTGCCTCATAAGCCCAGAGAGCTGAGTCAACCCCAGAACCCCAAATTAGGA
CAGAAGAGAAAACCGACTCCACCAAGTTGTTCTGATTGCTGTATGCATGCTGTGGGATGTGTTCTTGAAC
ATACAAAGTATGGGTTAAAATTTATTTTATTTTTAACTTCTTTGTGTCTCTGCATGTGTATGTGTACTAG
TGTGCAGCTGACCACAGAATCCAGAAGAAGGGATAGGATCTCTGGGGTGGAGTTACAGATGGTTGTGAGT
TGTACACTGTGGGTAATAGAAACCAAACTCGGGTCCTCTTAACCTCTCAGCCATCTCTCTGCAACCCCTC
AAAAAAATTTTAAATGCCGCTTTTAGGATTCAGGGTTAGGGTTAAGTAGAGAGAGAGTACATGCATAGCC
TGTGCAAAATCCTAGGTTCAACCCTAGCACCCCCAGACAACTGACAAGTATGGCATTTTTAGAGAAAATT
AATTGTCATGAGAAACTGTCGTTGTTATTCTGTTAAGGAAAAAACAAATTACAAATGGCAACTTCTCCTC
CCCTGTAGGGAAGATGTCCAGGTTCCTACACTCTCAGATGGTACCTACGTACCTATATGCCTTACTTAAG
ATAAAGTCTAATGTGTAAACTAAACAGACTAAGGTATTAACCGCACATTTTATTATTTAAAGATATGTCA
TCTTCCATTTTCAGTTTCCAGAAGAAATTTCTTATTTTGAAGAGGAAGAAAGAAAAGGAGTAGACAGATT
TATGGGGGGGCCTCCTGCCTACATGAACAAGTAAGCAAGCTGAGGGTGAGAATCCCACTAAGTCCAGTGT
AGGATGCATGCGTTGGGAGCATTTACTTACATGATTTCAGTTTTGTTGCAATTGGGGCTTGGGGCAAACT
GTTTGAGGTCTTTGAGGGATTTGTAGTGGATCGTGCCTCGGCTGGTGCTGATGCAGGAGCATCGTGCATT
CCTTATCACTAGGGTTCCTAGGCGGAAGATAATGCACATTACTTAGAATGACATCCTTTCGAATGAGGCT
TGTCTCAGTCACTATTGCTGCGACTGAGTGTCTGTGACTGCTTTTCAAGGTAGGTGGTATTTCCATTCTG
TATACCAGGAAGCCAAGGTTAAGGGCAAAGTCATTTAGCAAAAGGGAGCAGGGGAAGAACTTCATTTTAG
GTCATTTAGAGTTCTTAACAACATCACTTCACAACCTTGGAAGAAGAGAAAACCTCCATCATACTTAAAT
CCCTACTGTTAGACACACATATATGCAACCTGTCAGTACTACGGGGACCGGTTTCTTAAGCAGTTCCTCA
ATCTACTTCTTGCTACTGGGGTCATGGAGTTGATGTAGGTGTGGACAGAAAGCTCTACTTACAACAATTG
ATTACCATTTCAATCCTATTCCCTCTCATCCTCACTGCTCTGAAAAGTCTCTTTAAACCTATGTCTCCAT
CCCTTATTGCTTACCCAGGTCAGTGTCTATTTACACAGGTTTTGCCAACACACAGTAACTATGGCACACC
TACTTTACACACGTGGAAAACGCTCTCTAGGAAGGTTTTTTTTTTTTGTCCGAAGTAAGCAAAGTCATGA
ATAAGGAGGTCAAAGGCAATCTCTCTGACTTCTGAATTCTCAGTTGGTTAACCACAGACATTCTTATCAG
TGCACAGCATCGGTTGAGGAAAGTGATGCAGGAGACAACTTAGAAAAGGATCTCTTATGTCACTCTCTGT
TGCCAGGGCTGCGGATGAAATATTTCACAGGATAAATTCGAAGTAAAGCACCCAGAATCCCCTTTACATC
TGAGAAATGTTTTTTCATTATTAAAACATTTAAATATGCTTTGAACCCTCATTGGGAACTCACAATACCT
ACGCCAAGAAGGCATATTTAACTTGGCAGGTATAGATTACGACCTTTGGATAACTGCTCACAGCATCTAA
CTGCTTTGATGACCAAACAGTATTACTTTTTATTGCATGCAAGACATTCAGCTTTATCTGCTGGCCTGAG
AAGGCTTTTACGGTGATTCAGTCCTCAGAACTTACTAACGTAAAACTCCTCACCTCGAACTCCACACTGC
TCCAGGAAGATGATGCCCAAGAGGAAAAGAACAGCGGACTTCATGGCAGAGCTGAGTTCTATTGAGTCAC
TGTGTTGGAGTGAAGTCCGAGAATGTCTT
Protein Sequence
>gi|110626107|ref|NP_032625.2| C-X-C motif chemokine 9 precursor [Mus musculus]
MKSAVLFLLGIIFLEQCGVRGTLVIRNARCSCISTSRGTIHYKSLKDLKQFAPSPNCNKTEIIATLKNGD
QTCLDPDSANVKKLMKEWEKKISQKKKQKRGKKHQKNMKNRKPKTPQSRRRSRKTT
Molecule Role Vaximmutor
Related Vaccines(s) MVA/IL-15/5Mtb vaccine
References