VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

PepA

Gene Name PepA
Sequence Strain (Species/Organism) Mycobacterium tuberculosis H37Rv
VO ID VO_0010953
NCBI Gene ID 886924
NCBI Protein GI 15607267
Locus Tag Rv0125
Genbank Accession CP003248
Protein Accession NP_214639
Taxonomy ID 83332
Gene Starting Position 151147
Gene Ending Position 152214
Gene Strand (Orientation) +
Protein Name serine protease PepA
Protein pI 4.91
Protein Weight 30958.56
Protein Length 355
Protein Note Rv0125, (MTCI418B.07, MTB32A), len: 355 aa. Probable pepA (alternate gene name: mtb32a), serine protease (EC 3.4.21.-) (see Skeiky et al., 1999), highly similar to other proteases e.g. HHOB_ECOLI|P31137 protease hhob precursor (355 aa), FASTA scores: opt: 400, E(): 3.8e-14, (32.4% identity in 346 aa overlap). Also similar to Q50320 34 kDa PROTEIN PRECURSOR from Mycobacterium tuberculosis (361 aa), FASTA scores: opt: 1689, E(): 0, (70.7% identity in 362 aa overlap). Contains PS00135 Serine proteases, trypsin family, serine active site. Has a putative signal sequence at the N-terminus. BELONGS TO THE SERINE PROTEASE FAMILY.; mtb32a
DNA Sequence
>NC_000962.3:151147-152214 Mycobacterium tuberculosis H37Rv, complete genome
GATGAGCAATTCGCGCCGCCGCTCACTCAGGTGGTCATGGTTGCTGAGCGTGCTGGCTGCCGTCGGGCTG
GGCCTGGCCACGGCGCCGGCCCAGGCGGCCCCGCCGGCCTTGTCGCAGGACCGGTTCGCCGACTTCCCCG
CGCTGCCCCTCGACCCGTCCGCGATGGTCGCCCAAGTGGGGCCACAGGTGGTCAACATCAACACCAAACT
GGGCTACAACAACGCCGTGGGCGCCGGGACCGGCATCGTCATCGATCCCAACGGTGTCGTGCTGACCAAC
AACCACGTGATCGCGGGCGCCACCGACATCAATGCGTTCAGCGTCGGCTCCGGCCAAACCTACGGCGTCG
ATGTGGTCGGGTATGACCGCACCCAGGATGTCGCGGTGCTGCAGCTGCGCGGTGCCGGTGGCCTGCCGTC
GGCGGCGATCGGTGGCGGCGTCGCGGTTGGTGAGCCCGTCGTCGCGATGGGCAACAGCGGTGGGCAGGGC
GGAACGCCCCGTGCGGTGCCTGGCAGGGTGGTCGCGCTCGGCCAAACCGTGCAGGCGTCGGATTCGCTGA
CCGGTGCCGAAGAGACATTGAACGGGTTGATCCAGTTCGATGCCGCGATCCAGCCCGGTGATTCGGGCGG
GCCCGTCGTCAACGGCCTAGGACAGGTGGTCGGTATGAACACGGCCGCGTCCGATAACTTCCAGCTGTCC
CAGGGTGGGCAGGGATTCGCCATTCCGATCGGGCAGGCGATGGCGATCGCGGGCCAGATCCGATCGGGTG
GGGGGTCACCCACCGTTCATATCGGGCCTACCGCCTTCCTCGGCTTGGGTGTTGTCGACAACAACGGCAA
CGGCGCACGAGTCCAACGCGTGGTCGGGAGCGCTCCGGCGGCAAGTCTCGGCATCTCCACCGGCGACGTG
ATCACCGCGGTCGACGGCGCTCCGATCAACTCGGCCACCGCGATGGCGGACGCGCTTAACGGGCATCATC
CCGGTGACGTCATCTCGGTGACCTGGCAAACCAAGTCGGGCGGCACGCGTACAGGGAACGTGACATTGGC
CGAGGGACCCCCGGCCTG

Protein Sequence
>NP_214639.1 serine protease PepA [Mycobacterium tuberculosis H37Rv]
MSNSRRRSLRWSWLLSVLAAVGLGLATAPAQAAPPALSQDRFADFPALPLDPSAMVAQVGPQVVNINTKL
GYNNAVGAGTGIVIDPNGVVLTNNHVIAGATDINAFSVGSGQTYGVDVVGYDRTQDVAVLQLRGAGGLPS
AAIGGGVAVGEPVVAMGNSGGQGGTPRAVPGRVVALGQTVQASDSLTGAEETLNGLIQFDAAIQPGDSGG
PVVNGLGQVVGMNTAASDNFQLSQGGQGFAIPIGQAMAIAGQIRSGGGSPTVHIGPTAFLGLGVVDNNGN
GARVQRVVGSAPAASLGISTGDVITAVDGAPINSATAMADALNGHHPGDVISVTWQTKSGGTRTGNVTLA
EGPPA

Molecule Role Protective antigen
Related Vaccines(s) Mtb72f fusion protein
References