VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

PPE18

Gene Name PPE18
Sequence Strain (Species/Organism) Mycobacterium tuberculosis H37Rv
VO ID VO_0010954
NCBI Gene ID 886073
NCBI Protein GI 57116841
Locus Tag Rv1196
Genbank Accession AL123456
Protein Accession YP_177795
Taxonomy ID 83332
Gene Starting Position 1339348
Gene Ending Position 1340523
Gene Strand (Orientation) +
Protein Name PPE family protein PPE18
Protein pI 4.81
Protein Weight 36280.96
Protein Length 391
Protein Note Rv1196, (MTCI364.08), len: 391 aa. PPE18 (alternate gene name: mtb39a). Member of the Mycobacterium tuberculosis PPE family of glycine-rich proteins, highly similar to others e.g. Y07P_MYCTU|Q11031 hypothetical 40.0 kDa protein cy02b10.25c (396 aa), FASTA scores: opt: 2124, E(): 0, (85.1% identity in 397 aa overlap). Note that expression of Rv1196 was demonstrated in lysates by immunodetection (see Dillon et al., 1999).; mtb39a
DNA Sequence
>NC_000962.3:1339348-1340523 Mycobacterium tuberculosis H37Rv, complete genome
AATGGTGGATTTCGGGGCGTTACCACCGGAGATCAACTCCGCGAGGATGTACGCCGGCCCGGGTTCGGCC
TCGCTGGTGGCCGCGGCTCAGATGTGGGACAGCGTGGCGAGTGACCTGTTTTCGGCCGCGTCGGCGTTTC
AGTCGGTGGTCTGGGGTCTGACGGTGGGGTCGTGGATAGGTTCGTCGGCGGGTCTGATGGTGGCGGCGGC
CTCGCCGTATGTGGCGTGGATGAGCGTCACCGCGGGGCAGGCCGAGCTGACCGCCGCCCAGGTCCGGGTT
GCTGCGGCGGCCTACGAGACGGCGTATGGGCTGACGGTGCCCCCGCCGGTGATCGCCGAGAACCGTGCTG
AACTGATGATTCTGATAGCGACCAACCTCTTGGGGCAAAACACCCCGGCGATCGCGGTCAACGAGGCCGA
ATACGGCGAGATGTGGGCCCAAGACGCCGCCGCGATGTTTGGCTACGCCGCGGCGACGGCGACGGCGACG
GCGACGTTGCTGCCGTTCGAGGAGGCGCCGGAGATGACCAGCGCGGGTGGGCTCCTCGAGCAGGCCGCCG
CGGTCGAGGAGGCCTCCGACACCGCCGCGGCGAACCAGTTGATGAACAATGTGCCCCAGGCGCTGCAACA
GCTGGCCCAGCCCACGCAGGGCACCACGCCTTCTTCCAAGCTGGGTGGCCTGTGGAAGACGGTCTCGCCG
CATCGGTCGCCGATCAGCAACATGGTGTCGATGGCCAACAACCACATGTCGATGACCAACTCGGGTGTGT
CGATGACCAACACCTTGAGCTCGATGTTGAAGGGCTTTGCTCCGGCGGCGGCCGCCCAGGCCGTGCAAAC
CGCGGCGCAAAACGGGGTCCGGGCGATGAGCTCGCTGGGCAGCTCGCTGGGTTCTTCGGGTCTGGGCGGT
GGGGTGGCCGCCAACTTGGGTCGGGCGGCCTCGGTCGGTTCGTTGTCGGTGCCGCAGGCCTGGGCCGCGG
CCAACCAGGCAGTCACCCCGGCGGCGCGGGCGCTGCCGCTGACCAGCCTGACCAGCGCCGCGGAAAGAGG
GCCCGGGCAGATGCTGGGCGGGCTGCCGGTGGGGCAGATGGGCGCCAGGGCCGGTGGTGGGCTCAGTGGT
GTGCTGCGTGTTCCGCCGCGACCCTATGTGATGCCGCATTCTCCGGCGGCCGGCTA

Protein Sequence
>YP_177795.1 PPE family protein PPE18 [Mycobacterium tuberculosis H37Rv]
MVDFGALPPEINSARMYAGPGSASLVAAAQMWDSVASDLFSAASAFQSVVWGLTVGSWIGSSAGLMVAAA
SPYVAWMSVTAGQAELTAAQVRVAAAAYETAYGLTVPPPVIAENRAELMILIATNLLGQNTPAIAVNEAE
YGEMWAQDAAAMFGYAAATATATATLLPFEEAPEMTSAGGLLEQAAAVEEASDTAAANQLMNNVPQALQQ
LAQPTQGTTPSSKLGGLWKTVSPHRSPISNMVSMANNHMSMTNSGVSMTNTLSSMLKGFAPAAAAQAVQT
AAQNGVRAMSSLGSSLGSSGLGGGVAANLGRAASVGSLSVPQAWAAANQAVTPAARALPLTSLTSAAERG
PGQMLGGLPVGQMGARAGGGLSGVLRVPPRPYVMPHSPAAG

Molecule Role Protective antigen
Related Vaccines(s) Mtb72f fusion protein
References