VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

env from SIV

Gene Name env from SIV
Sequence Strain (Species/Organism) Simian immunodeficiency virus
NCBI Gene ID 1490007
NCBI Protein GI 9627208
Locus Tag SIVgp6
Genbank Accession M58410
Protein Accession NP_054372
Taxonomy ID 11723
Gene Starting Position 6201
Gene Ending Position 8765
Gene Strand (Orientation) ?
Protein Name envelope protein
Protein pI 8.73
Protein Weight 91594.7
Protein Length 854
DNA Sequence
>NC_001549.1:6201-8765 Simian immunodeficiency virus, complete genome
TATGGGGAGATTGCTTATAAAAATACTAATAATAGCAATAGGGATAAGTATAGGAATAGGTAACCTGTAT
GTGACAGTGTTTTATGGAATCCCAGTATGGAAAAATTCAACAGTTCAGGCATTTTGCATGACGCCCAATA
CCAATATGTGGGCAACCACCAACTGCATACCAGATGATCATGATAATACAGAGGTGCCTCTAAACATTAC
AGAAGCTTTCGAGGCTTGGGATAATCCGCTGGTAAAACAAGCAGAGAGTAATATACATCTACTCTTTGAA
CAAACGATGAGGCCTTGTGTTAAGCTCTCCCCCATATGTATTAAAATGTCCTGTGTAGAGCTGAATGGTA
CAGCCACGACAAAGGCCACCACTACTGCAACTACAACAATGACTACCCCCTGTCAGAATTGCAGTACAGA
GCAGATAGAAGGAGAAATGGCAGAGGAACCAGCATCCAACTGCACTTTTGCAATTGCAGGATATCAAAGA
GATGTAAAAAAGAATTATAGCATGACCTGGTATGATCAGGAGTTAGTCTGCAATAATAAAACAGGAAGTG
AAAAGGGAAGTAAGGATTGTTACATGATACATTGTAATGATTCAGTGATAAAAGAAGCTTGTGATAAAAC
ATATTGGGATACTTTAAGAGTAAGATACTGTGCACCAGCAGGGTATGCTTTGCTAAAATGTAATGATAAG
GATTATAGAGGCTTTGCTCCAAAGTGCAAGAATGTTTCAGTAGTGCATTGTACTAGATTAATCAATACTA
CTATAACTACAGGGATAGGATTAAATGGTAGTAGATCAGAAAATAGAACAGAGATATGGCAGAAAGGAGG
AAATGATAATGATACAGTTATAATAAAGTTGAATAAGTTTTACAACTTGACAGTGAGATGCCGAAGACCT
GGTAATAAAACAGTGTTGCCAGTAACAATCATGGCAGGGTTAGTATTTCACTCTCAGAAATATAATACCA
GGTTAAAACAAGCGTGGTGCCACTTCCAAGGAGATTGGAAAGGGGCATGGAAAGAAGTCAGAGAAGAAGT
AAAGAAAGTGAAAAATCTTACAGAAGTAAGCATAGAAAATATACATCTGAGAAGGATATGGGGAGATCCA
GAATCAGCGAATTTTTGGTTCAATTGTCAAGGTGAATTTTTCTATTGTAAGATGGACTGGTTTATCAATT
ATCTAAACAATCGAACAGAAGATGCAGAAGGTACTAATAGGACCTGTGACAAAGGGAAGCCAGGACCAGG
ACCATGTGTTCAGAGAACTTATGTTGCCTGCCATATACGACAAGTAGTAAATGATTGGTACACTGTCTCT
AAAAAGGTATATGCTCCACCAAGGGAAGGTCATTTGGAGTGTAACTCATCAGTCACGGCACTATACGTGG
CAATAGATTATAACAACAAGTCTGGCCCAATAAATGTGACCCTAAGTCCTCAGGTACGCAGCATATGGGC
GTACGAACTGGGAGACTATAAATTAGTAGAGATAACACCAATTGGCTTTGCTCCTACAGATGTAAGAAGA
TATACTGGCCCCACAAGAGAAAAAAGGGTGCCATTCGTGCTAGGGTTTCTAGGCTTCTTGGGAGCTGCTG
GAACTGCAATGGGCGCAGCGGCAACAACGCTGACAGTCCAGTCTCGGCATTTGCTTGCTGGGATATTGCA
GCAGCAGAAGAACTTGCTGGCGGCTGTGGAACAGCAACAACAGTTGTTGAAGCTGACCATTTGGGGTGTG
AAAAACCTCAATGCCCGCGTCACAGCTCTCGAGAAGTACCTAGAGGATCAGGCACGGCTAAATTCATGGG
GATGTGCGTGGAAACAAGTATGTCACACCACAGTGCCATGGAAGTATAATAACACTCCTAAGTGGGACAA
TATGACTTGGTTGGAGTGGGAGAGACAAATTAATGCCTTGGAAGGCAACATAACTCAACTATTGGAAGAA
GCACAAAATCAGGAATCAAAGAATCTGGATCTGTACCAGAAATTGGATGATTGGTCAGGGTTCTGGTCAT
GGTTCTCACTGTCAACTTGGTTAGGCTATGTTAAAATAGGATTTTTAGTGATAGTGATTATTCTAGGATT
AAGATTTGCATGGGTATTATGGGGATGTATCAGAAATATTAGGCAGGGATATAATCCTCTCCCCCAGATC
CATATCCACAGTTCAGCGGAACGGCCAGACAACGGAGGAGGGCAAGACAGAGGTGGAGAAAGCAGCAGCA
GCAAATTGATAAGATTGCAGGAAGAGTCCTCAACACCTTCGAGGATCAACAACTGGTGGCTCAACTTCAA
GAGCTGCAGCTTGAGAATAAGGACTTGGTGTTACAACATCTGCCTGACCCTCCTCATATTCATCAGGACA
GCAGTGGGATACCTGCAGTATGGGCTCCAGCAACTCCAAGAGGCAGCAACAGGGCTTGCTCAAGCTCTGG
CGAGGGCTGCGAGGGAAGCCTGGGGCAGACTGGGTGCTATTGTCCGATCCGCTTATCGGGCAGTCATCAA
CAGTCCAAGAAGAGTGCGGCAAGGCCTTGAAAAAGTCCTGGGGTA

Protein Sequence
>NP_054372.1 envelope protein [Simian immunodeficiency virus]
MGRLLIKILIIAIGISIGIGNLYVTVFYGIPVWKNSTVQAFCMTPNTNMWATTNCIPDDHDNTEVPLNIT
EAFEAWDNPLVKQAESNIHLLFEQTMRPCVKLSPICIKMSCVELNGTATTKATTTATTTMTTPCQNCSTE
QIEGEMAEEPASNCTFAIAGYQRDVKKNYSMTWYDQELVCNNKTGSEKGSKDCYMIHCNDSVIKEACDKT
YWDTLRVRYCAPAGYALLKCNDKDYRGFAPKCKNVSVVHCTRLINTTITTGIGLNGSRSENRTEIWQKGG
NDNDTVIIKLNKFYNLTVRCRRPGNKTVLPVTIMAGLVFHSQKYNTRLKQAWCHFQGDWKGAWKEVREEV
KKVKNLTEVSIENIHLRRIWGDPESANFWFNCQGEFFYCKMDWFINYLNNRTEDAEGTNRTCDKGKPGPG
PCVQRTYVACHIRQVVNDWYTVSKKVYAPPREGHLECNSSVTALYVAIDYNNKSGPINVTLSPQVRSIWA
YELGDYKLVEITPIGFAPTDVRRYTGPTREKRVPFVLGFLGFLGAAGTAMGAAATTLTVQSRHLLAGILQ
QQKNLLAAVEQQQQLLKLTIWGVKNLNARVTALEKYLEDQARLNSWGCAWKQVCHTTVPWKYNNTPKWDN
MTWLEWERQINALEGNITQLLEEAQNQESKNLDLYQKLDDWSGFWSWFSLSTWLGYVKIGFLVIVIILGL
RFAWVLWGCIRNIRQGYNPLPQIHIHSSAERPDNGGGQDRGGESSSSKLIRLQEESSTPSRINNWWLNFK
SCSLRIRTWCYNICLTLLIFIRTAVGYLQYGLQQLQEAATGLAQALARAAREAWGRLGAIVRSAYRAVIN
SPRRVRQGLEKVLG

Molecule Role Protective antigen
Related Vaccines(s) HIV DNA vaccine Ad26/Ad5HVR48 encoding HIV or SIV env or gag , NYVAC-SIV , rMVTT-SIV-gpe
References