VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

P39 from Brucella abortus

Gene Name P39 from Brucella abortus
Sequence Strain (Species/Organism) Brucella abortus bv. 1 str. 9-941
NCBI Protein GI 68067499
Other Database IDs CDD:224567
Taxonomy ID 262698
Gene Strand (Orientation) ?
Protein Name Probable sugar-binding periplasmic protein
Protein pI 5.06
Protein Weight 44330.68
Protein Length 589
Protein Note biovar: 1 str. 9-941
Protein Sequence
>sp|O06875.3|SP39_BRUAB RecName: Full=Probable sugar-binding periplasmic protein; AltName: Full=Immunogenic 39 kDa protein; AltName: Full=P39; Flags: Precursor
MHKLLKLAAMGTAACALLAGMAPVANAQEKQNVEVLHWWTSGGEASALEVLKKDLESKGISWTDMPVAGG
GGTEAMTVLRARVTAGNAPTAVQMLGFDIRDWAEQGALGNLDTVASKEGWEKVIPAPLQEFAKYDGHWIA
APVNIHSTNWMWINKAALDKAGGKEPTNWDELIALLDNFKAQGITPIAHGGQPWQDATIFDAVVLSFGPD
FYKKAFIDLDPEALGSDTMKQAFDRMSKLRTYVDDNFSGRDWNLASAMVIEGKAGVQFMGDWAKGEFLKA
GKKPGEDFVCMRYPGTQGAVTFNSDMFAMFKVSEDKVPAQLEMASAIESPAFQSAFNVVKGSAPARTDVP
DTAFDACGKKAIADVKEANSKGTLLGSMAHGYANPAAVKNAIYDVVTRQFNGQLSSEDAVKELVAAVEAA
K

Molecule Role Protective antigen
Related Vaccines(s) B. abortus DNA vaccine pcDNA3.1-p39-L7/L12 encoding p39-L7/L12 fusion protein
References