VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Sm23

Gene Name Sm23
Sequence Strain (Species/Organism) Schistosoma mansoni
NCBI Protein GI 511890
Other Database IDs CDD:278750
CDD:239401
Taxonomy ID 6183
Gene Strand (Orientation) ?
Protein Name integral membrane protein 23
Protein pI 6.44
Protein Weight 21503.36
Protein Length 286
Protein Note Tetraspanin family; pfam00335
Protein Sequence
>AAA73525.1 integral membrane protein 23 [Schistosoma mansoni]
MATLGTGMRCLKSCVFVLNIICLLCSLVLIGAGAYVEVKFSQYGDNLHKVWQAAPIAIIVVGVIILIVSF
LGCCGAIKENVCMLYMYAFFLVVLLIAELAAAIVAVVYKDRIDSEIDALMTGALDKPTKEITEFMNLIQS
SFHCCGAKGPNDYRGNVPASCKEENLTYTEGCVSVFGAFLKRNLVIVACVAFGVCFFQLLSIVIACCLGR
QIKEYENV

Molecule Role Protective antigen
Related Vaccines(s) S. mansoni DNA vaccine Sm23-pcDNA encoding Sm23
References