VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

SOD

Gene Name SOD
Sequence Strain (Species/Organism) Schistosoma mansoni strain NMRI
NCBI Protein GI 161119
Other Database IDs CDD:238186
Taxonomy ID 6183
Gene Strand (Orientation) ?
Protein Name superoxide dismutase
Protein pI 6.58
Protein Weight 14406.56
Protein Length 212
Protein Note Copper/zinc superoxide dismutase (SOD). superoxide dismutases catalyse the conversion of superoxide radicals to molecular oxygen. Three evolutionarily distinct families of SODs are known, of which the copper/zinc-binding family is one. Defects in the...; cd00305
Protein Sequence
>AAA29935.1 superoxide dismutase [Schistosoma mansoni]
MKAVCVMTGTAGVKGVVKFTQETDNGPVHVHAEFSGLKAGKHGFHVHEFGDTTNGCTSAGAHFNPTKQEH
GAPEDSIRHVGDLGNVVAGADGNAVYNATDKLISLNGSHSIIGRSMVIHENEDDLGRGGHELSKVTGNAG
GRLACGVVGLAAE

Molecule Role Protective antigen
Related Vaccines(s) S. mansoni DNA vaccine pcDNA/CTSOD encoding SOD
References