VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

cjaA

Gene Name cjaA
Sequence Strain (Species/Organism) P. vivax SouthernMex-62 isolate
VO ID VO_0010957
3D structure: PDB ID 1Z27
Other Database IDs CDD:270412
GOA:P94643
InterPro: IPR001638
UniProtKB/TrEMBL: P94643
Taxonomy ID 197
Gene Strand (Orientation) ?
Protein pI 4.9
Protein Weight 29158.88
Protein Length 324
Protein Note Substrate binding domain of ABC cysteine transporter; the type 2 periplasmic binding protein fold; cd13694
DNA Sequence
>gi|154184258:1-660 Plasmodium vivax isolate SouthernMex-62 ookinete surface protein (Pvs25) gene, complete cds
ATGAACTCCTACTACAGCCTCTTCGTTTTTTTCCTCGTCCAAATTGCGCTAAAGTATAGCAAGGCAGCCG
TCACGGTAGACACCATATGCAAAAATGGACAGCTGGTTCAAATGAGTAACCACTTTAAGTGTATGTGTAA
CGAAGGGCTGGTGCACCTTTCCGAAAATACATGTGAAGAAAAAAATGAATGCAAGAAAGAAACCCTAGGC
AAAGCATGCGGGGAATTTGGCCAGTGTATAGAAAACCCAGACCCAGCAAAGGTAAACATGTACAAATGTG
GTTGCATTGAGGGCTACACTTTGAAGGAAGACACTTGTGTGCTTGATGTATGTCAATACAAAAATTGTGG
AGAAAGTGGCGAATGCATTGTTGAGTACCTCTCGGAAACCCAAAGTGCAGGTTGCTCATGTGCTATTGGC
AAAGTCCCCAATCCAGAAGATGAGAAAAAATGTACCAAAACGGGAGAAACTGCTTGTCAATTGAAATGTA
ACACAGATAATGAAGTCTGCAAAAATGTTGAAGGAGTTTACAAGTGCCAGTGTATGGAAGGCTTTACGTT
CGACAAAGAGAAAAATGTATGCCTTTCCTATTCTGTATTTAACATCCTAAACTACTCCCTCTTCTTTATC
ATCCTGCTTGTCCTTTCGTACGTCATATAA
Protein Sequence
>CAA71822.1 cjaA [Campylobacter jejuni]
MKKMLLSIFTTFVAVFLAACGGNSDSGASNSLERIKQDGVVRIGVFGDKPPFGYVDEKGVNQGYDIVLAK
RIAKELLGDENKVQFVLVEAANRVEFLKSNKVDIILANFTQTPERAEQVDFCLPYMKVALGVAVPQDSNI
SSIEDLKDKTLLLNKGTTADAYFTKEYPDIKTLKYDQNTETFAALIDQRGDALSHDNTLLFAWVKEHPEF
KMAIKELGNKDVIAPAVKKGDKELKEFIDNLITKLGEEQFFHKAYDETLKSHFGDDVKADDVVIEGGKI

Molecule Role Protective antigen
Related Vaccines(s) P. vivax PVS25 with Montanide ISA-720
References