VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

ORF5

Gene Name ORF5
Sequence Strain (Species/Organism) Porcine reproductive and respiratory syndrome virus
NCBI Protein GI 14250961
Other Database IDs CDD:109986
Taxonomy ID 28344
Gene Strand (Orientation) ?
Protein Name GP5 envelope protein
Protein pI 8.7
Protein Weight 20800.27
Protein Length 291
Protein Note genotype: North America
Protein Sequence
>AAK44216.1 GP5 envelope protein [Porcine reproductive and respiratory syndrome virus]
MLGKCLTTGCCSRLLSLWCIVPFCFAVLVNANSNSSSHFQLIYNLTLCELNGTDWLANKFDWAVETFVIF
PVLTHIVSYGALTTSHFLDTVGLVTVSTAGFYHGRYVLSSIYAVCALAALICFVIRLAKNCMSWRYSCTR
YTNFLLDTKGRLYRWRSPVIVEKGGKVEVEGHLIDLKRVVLDGSVATPLTRVSAEQWGRL

Molecule Role Protective antigen
Related Vaccines(s) PRRSV DNA vaccine pCA-U-optiGP5 , PRRSV DNA vaccine pIRESorf5/IFNγ , PRRSV DNA vaccine pIRESorf5/IL-2
References