VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Cov19VaxKB
Vaccine Mechanisms
VaximmutorDB
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign2
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

ORF7

Gene Name ORF7
Sequence Strain (Species/Organism) Porcine reproductive and respiratory syndrome virus CH-1a
NCBI Protein GI 14250964
Other Database IDs CDD:110480
Taxonomy ID 28344
Gene Strand (Orientation) ?
Protein Name nucleocapsid protein
Protein pI 10.87
Protein Weight 13394.22
Protein Length 213
Protein Note genotype: North America
Protein Sequence
>AAC15449.2 nucleocapsid protein [Porcine reproductive and respiratory syndrome virus]
MPNNNGKQRKKKKGNGQPVNQLCQMLGKIIAQQNQSRGKGPGKKNKKKSPEKPHFPLATEDDVRHHFTPS
ERQLCLSSIQTAFNQGAGTCTLSDSGRISYTVEFSLPTHHTVRLIRVTASPSA

Molecule Role Protective antigen
Related Vaccines(s) PRRSV DNA vaccine pIRESorf7/IL-2
References