VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

MSP-1

Gene Name MSP-1
Sequence Strain (Species/Organism) Plasmodium falciparum
VO ID VO_0010958
NCBI Protein GI 94420988
Other Database IDs CDD:289698
CDD:304395
Taxonomy ID 5833
Gene Strand (Orientation) ?
Protein Name merozoite surface protein 1
Protein pI 4.55
Protein Weight 13136.57
Protein Length 192
Protein Note clinical isolate
Protein Sequence
>ABF18819.1 merozoite surface protein 1, partial [Plasmodium falciparum]
MLNISQHQCVKKQCPENSGCFRHLDEREECKCLLNYKQEGDKCVENPNPTCNENNGGCDADATCTEEDSG
SSRKKITCECTKPDSYPLFDGIFCSSSNFLGISFLLILMLILYSFI

Molecule Role Protective antigen
Molecule Role Annotation Aotus monkeys were challenged with the virulent Vietnam Oak Knoll (FVO) strain of P. falciparum. Vaccination of A. nancymai with yMSP1(19) induced protective immune responses. Both of the A. nancymai vaccinated with yMSP1(19) self-resolved an otherwise lethal infection (Kumar et al., 1995).
Related Vaccines(s) P. falciparum MSP1 from transgenic mice with Freund's adjuvant , P. falciparum vaccine Combination B
References