VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign2
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

JUN

Gene Name JUN
Sequence Strain (Species/Organism) Homo sapiens
NCBI Gene ID 3725
NCBI Protein GI 4758616
Genbank Accession ABBA01074656
Protein Accession NP_002219
Taxonomy ID 9606
Chromosome No 1
Gene Starting Position 59246462
Gene Ending Position 59249784
Gene Strand (Orientation) -
Protein Name jun proto-oncogene
Protein pI 9.12
Protein Weight 34087.18
Protein Length 331
Protein Note Also known as AP1; AP-1; c-Jun
DNA Sequence
>gi|224589800:59246462-59249784 Homo sapiens chromosome 1, GRCh37.p10 Primary Assembly
ATTGGTATTTGAATACATTTATTGTGACAAGAATGCTGTTATAAATATTCATAAGCAAAGGCCATCTTTT
TATCTAGGAATTGTCAAAGAGAAGATTCCAAATTGGAAGGATACATCTTTTGTAAAATCTGCCACCAATT
CCTGCTTTGAGAATAAGCACCTATTGTAAAATTTCTACTAACATTATAAATGGTCACAGCACATGCCACT
TGATACAATCCAAACTTTGAAATGTTTGACTTCTCAGTGGGCTGTCCCTCTCCACTGCAACCCCCCTTCC
TCCAGCCTCCTGAAACATCGCACTATCCTTTGGTAAGCAATTCCATATAGATAGCTGGGGGAGGAGGAGT
ATAACCTGACCATAGCATCAGGTACATCAGGTACATTTATTTCTAAAGTCTAATAGAGAACAGTTTTTAC
TGCTTAATAGTAAGAAGCACTGAGAGTGATTTTAATCGACATTCTTAACTCTTTCAACTCCACCTAGATA
GCTAGTATCTACAGATGATGCAGAAAAGAGGTTAGGGGAGTACTTTCCAATAGTTTATTGTATTTTCTTA
AATATCCTTTCTGGAATTTTCAGAAACAAAACATAAAAAAATTATATACTTTATTACAAATGGTAAACTC
AGAGTGCTCCAAATCTCTTATTTACAAACAACACTGGGCAGGATACCCAAACAAACAAACAAGAAATAAC
TTACAAAGGCATGAAGCTGTTTATTGACAGTAATCAGCTTTCATCAAATTAAAAAATATATATATGTACA
TACACAGTTAACGAAGGCAGGCCAGAAAGAGTTCATCTGTAGGCTCAGCCTCGCTCTCACAAACCTCCCT
CCTGCCGCCCCTCCCCAACCCTCCCCCCGCTTTGTGTTCTTAAGGAGTACTACAGAAGCAATCTACAGTC
TCTATTGCAGTTTGTAACCCCCTCCCCCTCCCCCCTTTAATACTGAATGAGATCGAATGTTAGGTCCATG
CAGTTCTTGGTCAATGTTAACGAAAAGTCCAACGTTCCGTTCGCGCGGGGACAGCCCGTCCGCAAAGCGG
GGCAGCCCGCAGGCGGCCGCTCCCTGGCTCCACGCCAAGGGAGGGCGCGCCAAGTCCTTCCCACTCGTGC
ACACTGGGGGCGCCGTCAGGACGCAACCCAGTCCAACTTGGATACCCTTGGCTTTAGTTCTCGGACACTT
CTTTTTTCTCTCCGTCGCAACTTGTCAAGTTCTCAAGTCTGTCTCTCTGTGTTATTTTTTTTCTTCGTTG
CCCCTCAGCCCCCGACGGTCTCTCTTCAAAATGTTTGCAACTGCTGCGTTAGCATGAGTTGGCACCCACT
GTTAACGTGGTTCATGACTTTCTGTTTAAGCTGTGCCACCTGTTCCCTGAGCATGTTGGCCGTGGACGCC
AGCTCCGAGTTCTGAGCTTTCAAGGTTTTCACTTTTTCCTCCAGCCGGGCGATTCTCTCCAGCTTCCTTT
TTCGGCACTTGGAGGCAGCGATGCGGTTCCTCATGCGCTTCCTCTCCGCCTTGATCCGCTCCTGGGACTC
CATGTCGATGGGGGACAGGGGCGGTGTCTCGCCGGGCATCTCGGGCACTGTCTGAGGCTCCTCCTTCAGG
GCCTGCAGCCGCGGGTGCTGCACGGGCATCTGCTGGGGCAGGTGGTGCGGCGGCTGCTGCTGCTGCTGGG
GTTGCGCGGGAAAGGCCAGGCCGGCCGCGCCGTAGGAGGGCGCCCCGCCGCCGCTGCTCAGCGCGCCTGG
GTTGAAGTTGCTGAGGTTTGCGTAGACCGGCGGCTCGCTGTGCAGGCTGGCGCTGAAGCCGCCGCTGCCG
CTGCCCCCTGCCACCGAGGCTACCGCGGGAGCCACCATGCCTGCCCCGTTGACCGGCTGCGCCGCCGACG
TGACGCTGGGCAGCGTGTTCTGGCTGTGCAGTTCGGCCAGGGCGCGCACGAAGCCCTCGGCGAAGCCCTC
CTGCTCATCTGTCACGTTCTTGGGGCACAGGAACTGGGTGGGGGTCGGCGTGGTGGTGATGTGCCCGTTG
CTGGACTGGATTATCAGGCGCTCCAGCTCGGGCGACGCCAGCTTGAGCAGCCCCACGTCGGGCGAGGTGA
GGAGGTCCGAGTTCTTGGCGCGGAGGTGCGGCTTCAGGCTCCCCACTGGGTCGGCCAGGTTCAGGGTCAT
GCTCTGTTTCAGGATCTTGGGGTTACTGTAGCCATAAGGTCCGCTCTCGGACGGGAGGAACGAGGCGTTG
AGGGCATCGTCATAGAAGGTCGTTTCCATCTTTGCAGTCATAGAACAGTCCGTCACTTCACGTGAGGTTA
GTTTGGGCTGCGCGCACAAGTTTCGGGGCCGCAACAGGGCTGTGGCAAGCGGGGGACACCCGCGCCCCCC
GGAGCCTTTGACAGGGAAAGTTTCTCTAAGAGCGCACGCACCCGCTGGCTGTCGTCCCCGCTGCGCCCTC
CTCACCAGCTCGCTCCAGGGAGCGCAGGGTTAATTAAGATGCCTCCCGCACTCTTACTTGTCGACTCGCG
CGCGCTACCCGGCTTTGAAAAGTCGCGGTCACTCACTGAGCGCTCTTCGTGCGCAGCGGTTCCTCGGAGT
CCGCAGGCGAACTCACTTCCCAGAGCAGCGGCTCTCCCCGCGGAGCGGATCAGTGCGGACCCTGCAGTGG
CCGGCCGGCGGCGGGTCTTGGCCGCCCGGACTCCGACGACTTGTCCCCTCCTCCGCTGCTAGGGGGAGGG
GGCGCCCGGCAGCCGCGGCTCGCGCTCGCCCAAGTTCAACAACCGGTGCGAGCGAAGCTGAGCGCACGTC
CTTCTTCTCTTGCGTGGCTCTCCGCCGCCTTCTGGTCTTTACCGCCGTGGAGAAGCCTAAGACGCAGGAA
AGGCTTGCAAAAGTTGGCTCCGGGACTCTGCCACTTGTCTCCGGTCCTCCCAGCCGGGAAAGTTCTTTGC
TGCTGCAGCCGCTCGCCGACTTCCCCCGGCGGGCGCGTGGGTACCGCTGCTTTCCGCCGCTGTCAACAGC
GCCTGGGCAGCAGGGCTCTCCTCCCGGGGGCGGCTGGAGACCAGGCTCTCTGGACACTCCCGAAACACCA
GCCCGGGAGCCACAGGCGCTAGCTCTGGGCAGTTAGAGAGAAGGTGAAAAGAAAATAAGATTTGCAGTTC
GGACTATACTGCCGACCTGGCTGGCTGGCTGTGTCTGTCTGTCTGCCTGACTCCGCGCACCTCCACTCCC
GCCTCGCTGCTTCAGCCACACTCAGTGCAACTCTGAGCCCTTATCCAGCCCGAGCTCAACACTTATCTGC
TACCAGTCAACCCCTAAAAATAGCCCATGATGT
Protein Sequence
>gi|4758616|ref|NP_002219.1| transcription factor AP-1 [Homo sapiens]
MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLK
LASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGA
GMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHH
LPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARL
EEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
Molecule Role Vaximmutor
Related Vaccines(s) FluMist
References