VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

omp31

Gene Name omp31
Sequence Strain (Species/Organism) Brucella melitensis bv. 1 str. 16M
NCBI Protein GI 61229373
Other Database IDs CDD:226163
Taxonomy ID 224914
Gene Strand (Orientation) ?
Protein Name 31 kDa outer-membrane immunogenic protein
Protein pI 5.06
Protein Weight 24732.46
Protein Length 343
Protein Note biovar: 1 str. 16M
Protein Sequence
>sp|P0A3U4.1|OM31_BRUME RecName: Full=31 kDa outer-membrane immunogenic protein; Flags: Precursor
MKSVILASIAAMFATSAMAADVVVSEPSAPTAAPVDTFSWTGGYIGINAGYAGGKFKHPFSSFDKEDNEQ
VSGSLDVTAGGFVGGVQAGYNWQLDNGVVLGAETDFQGSSVTGSISAGASGLEGKAETKVEWFGTVRARL
GYTATERLMVYGTGGLAYGKVKSAFNLGDDASALHTWSDKTKAGWTLGAGAEYAINNNWTLKSEYLYTDL
GKRNLVDVDNSFLESKVNFHTVRVGLNYKF

Molecule Role Protective antigen
Related Vaccines(s) B. melitensis DNA vaccine pCI-Omp31 , B. melitensis DNA vaccine pCIBLSOmp31 encoding BLSOmp31 (fusion protein)
References