VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

IRBP from humans

Gene Name IRBP from humans
Sequence Strain (Species/Organism) Homo sapiens
NCBI Gene ID 5949
NCBI Protein GI 4506453
Genbank Accession AH002852
Protein Accession NP_002891
Taxonomy ID 9606
Chromosome No 10
Gene Starting Position 47348370
Gene Ending Position 47357874
Gene Strand (Orientation) +
Protein Name retinol binding protein 3
Protein pI 4.76
Protein Weight 124350.97
Protein Length 1247
Protein Note Also known as IRBP; RBPI; D10S64; D10S65; D10S66
DNA Sequence
>NC_000010.11:47348370-47357874 Homo sapiens chromosome 10, GRCh38.p12 Primary Assembly
CTGTCCACCAGCTGAGAAGGACAAGGGCGGAAGGCAGCTGCACAGAGCAGGGCCACGGCCTTGCACACAG
TCCAGGGAGCTTTTGTGCAGGAGCCAGGCCTCCCCCTGGGTCCCCATGATGAGAGAATGGGTTCTGCTCA
TGTCCGTGCTGCTCTGTGGCCTGGCTGGCCCCACACACCTGTTCCAGCCAAGCCTGGTGCTGGACATGGC
CAAGGTCCTCTTGGATAACTACTGCTTCCCGGAGAACCTGCTGGGCATGCAGGAAGCCATCCAGCAGGCC
ATCAAGAGCCATGAGATTCTGAGCATCTCAGACCCGCAGACGCTGGCCAGTGTGCTGACAGCCGGGGTGC
AGAGCTCCCTGAACGATCCTCGCCTGGTCATCTCCTATGAGCCCAGCACCCCCGAGCCTCCCCCACAAGT
CCCAGCACTCACCAGCCTCTCAGAAGAGGAACTGCTTGCCTGGCTGCAAAGGGGCCTCCGCCATGAGGTT
CTGGAGGGTAATGTGGGCTACCTGCGGGTGGACAGCGTCCCGGGCCAGGAGGTGCTGAGCATGATGGGGG
AGTTCCTGGTGGCCCACGTGTGGGGGAATCTCATGGGCACCTCCGCCTTAGTGCTGGATCTCCGGCACTG
CACAGGAGGCCAGGTCTCTGGCATTCCCTACATCATCTCCTACCTGCACCCAGGGAACACCATCCTGCAC
GTGGACACTATCTACAACCGCCCCTCCAACACCACCACGGAGATCTGGACCTTGCCCCAGGTCCTGGGAG
AAAGGTACGGTGCCGACAAGGATGTGGTGGTCCTCACCAGCAGCCAGACCAGGGGCGTGGCCGAGGACAT
CGCGCACATCCTTAAGCAGATGCGCAGGGCCATCGTGGTGGGCGAGCGGACTGGGGGAGGGGCCCTGGAC
CTCCGGAAGCTGAGGATAGGCGAGTCTGACTTCTTCTTCACGGTGCCCGTGTCCAGGTCCCTGGGGCCCC
TTGGTGGAGGCAGCCAGACGTGGGAGGGCAGCGGGGTGCTGCCCTGTGTGGGGACTCCGGCCGAGCAGGC
CCTGGAGAAAGCCCTGGCCATCCTCACTCTGCGCAGCGCCCTTCCAGGGGTAGTCCACTGCCTCCAGGAG
GTCCTGAAGGACTACTACACGCTGGTGGACCGTGTGCCCACCCTGCTGCAGCACTTGGCCAGCATGGACT
TCTCCACGGTGGTCTCCGAGGAAGATCTGGTCACCAAGCTCAATGCCGGCCTGCAGGCTGCGTCTGAGGA
TCCCAGGCTCCTGGTGCGAGCCATCGGGCCCACAGAAACTCCTTCTTGGCCCGCGCCCGACGCTGCAGCC
GAAGACTCACCAGGGGTGGCCCCAGAGTTGCCTGAGGACGAGGCTATCCGGCAAGCACTGGTGGACTCTG
TGTTCCAGGTGTCGGTGCTGCCAGGCAATGTGGGCTACCTGCGCTTCGATAGTTTTGCTGACGCCTCCGT
CCTGGGTGTGTTGGCCCCATATGTCCTGCGCCAGGTGTGGGAGCCGCTACAGGACACGGAGCACCTCATC
ATGGACCTGCGCCACAACCCTGGAGGGCCATCCTCTGCTGTGCCCCTGCTCCTGTCCTACTTCCAGGGCC
CTGAGGCCGGCCCCGTGCACCTCTTCACCACCTATGATCGCCGCACCAACATCACGCAGGAGCACTTCAG
CCACATGGAGCTCCCGGGCCCACGCTACAGCACCCAACGTGGGGTGTATCTGCTCACCAGCCACCGCACC
GCCACGGCCGCGGAGGAGTTCGCCTTCCTTATGCAGTCGCTGGGCTGGGCCACACTGGTAGGTGAGATCA
CCGCGGGCAACCTGCTGCACACCCGCACGGTGCCGCTGCTGGACACACCCGAAGGCAGCCTCGCGCTCAC
CGTGCCGGTCCTCACCTTCATCGACAATCACGGCGAGGCCTGGCTGGGTGGTGGAGTGGTGCCCGATGCC
ATCGTGCTGGCCGAGGAGGCCCTGGACAAAGCCCAGGAAGTGCTGGAGTTCCACCAAAGCCTGGGGGCCT
TGGTGGAGGGCACAGGGCACCTGCTGGAGGCCCACTATGCTCGGCCAGAGGTCGTGGGGCAGACCAGTGC
CCTCCTGCGGGCCAAGCTGGCCCAGGGCGCCTACCGCACAGCTGTGGACTTGGAGTCTCTGGCCTCTCAG
CTCACAGCAGACCTCCAGGAGGTGTCTGGGGACCACCGCTTGCTAGTGTTCCACAGCCCTGGCGAGCTGG
TGGTAGAGGAAGCACCCCCACCACCCCCTGCTGTCCCCTCTCCAGAGGAGCTCACCTACCTTATTGAGGC
CCTGTTCAAGACAGAGGTGCTGCCCGGCCAGCTGGGCTACCTGCGTTTTGACGCCATGGCTGAACTGGAG
ACAGTGAAGGCCGTGGGGCCACAGCTGGTGCGGCTGGTATGGCAACAGCTGGTGGACACGGCTGCGCTGG
TGATCGACCTGCGCTACAACCCTGGCAGCTACTCCACGGCCATCCCGCTGCTCTGCTCCTACTTCTTTGA
GGCAGAGCCCCGCCAGCACCTGTATTCTGTCTTTGACAGGGCCACCTCAAAAGTCACGGAGGTGTGGACC
TTGCCCCAGGTCGCCGGCCAGCGCTACGGCTCACACAAGGACCTCTACATCCTGATGAGCCACACCAGTG
GCTCTGCGGCCGAGGCCTTTGCACACACCATGCAGGACCTGCAGCGGGCCACGGTCATTGGGGAGCCCAC
GGCCGGAGGCGCACTCTCTGTGGGCATCTACCAGGTGGGCAGCAGCCCCTTATATGCATCCATGCCCACC
CAGATGGCCATGAGTGCCACCACAGGCAAGGCCTGGGACCTGGCTGGTGTGGAGCCCGACATCACTGTGC
CCATGAGCGAAGCCCTTTCCATAGCCCAGGACATAGTGGCTCTGCGTGCCAAGGTGCCCACGGTGCTGCA
GACGGCCGGGAAGCTGGTGGCTGATAACTATGCCTCTGCCGAGCTGGGGGCCAAGATGGCCACCAAACTG
AGCGGTCTGCAGAGCCGCTACTCCAGGGTGACCTCAGAAGTGGCCCTAGCCGAGATCCTGGGGGCTGACC
TGCAGATGCTCTCCGGAGACCCACACCTGAAGGCAGCCCATATCCCTGAGAATGCCAAGGACCGCATTCC
TGGAATTGTGCCCATGCAGGTGAGACCCAAGAGAGACCTGGCTGAACCCAGTCCCGGGAGTGAGTTGACC
CATTGTCCGCACATGCAGGGCTCTGTGCACAGTGCGTGACAATGGCTTTTAGATTTGTTCTCACGTTTAA
GTTTTGACCGGTCAAGTCCTTTCCTCTTTCTCAACCTGTTCCATCCACTCTCTGTGACCCTGGGGTTGCT
GAACACCTCTGTAGAACATTCATATTAGGTTGGTGCAAAAGTACTTTCAATGGCAAAACCCGCAATTACT
TTTGCACCCACCTCACAGGAAGCCAGTTTGAAAGCCAACCAATACTCACAGGAAGCCAGTTCGGAAGCTC
CTGGGATAGAAGGCATTTCAGCCTTGGCTGGGTGGAAGGTGAGTGTTGGCAGGGCTTCTCATTGTCAGTG
CTAGGGAAGAGGCCAACACCTGTCAGAGGTGGCCAATGGACTTCACCAAGTGCCCCACGCTGGCCGAGAG
CTCCACCTAGGCAGCACTCACACCTCCACACTGTTCTACCTGTGGTCTGCTGCATCGTCACAATTGGGCA
GGGCAGCATTTGCCATGGGATCCCTTGCAAGGAGGGTCTGAGACCAGGGCTTGGGTGCAGGCGCTTTGTC
TGGGAGGCGGTTACTGAAGCAGGCATGAAGGAGGGAGCAGGGAGAGTGGGTTGGGAAGCTGACAGGCAGG
TGCCTCAAAGCTGTTCTGCTGAAGCCAGGACCCTGACGAGTGCAGGGATGCTCCCAGGCATAGCCCTCTG
CAGGCAGGGCCCAGTGGTTCCTGTCCCGCATTGGCCAAGAGTTGCCCTGAGACATGCCTCAGGGTGGGGC
AGGCTCCCTCTTCTTGGAGAAGGCCTGAGCTACGGGTGGAAAGGCAGGGCTGTGCTATAGGAGAGCCTGT
CAGTGGGGTCGGGTGCAGCTGAAAGCAGAGGGGGCTGAGAGTGCCAAAAGCATCTACTACAGAATTGTTA
TCCCCATTTTCCGCAACTGAGGCCCGGAGAGGAGCAGAGGGGAGTGGCCTGAGGCCAGAGAGCTGTGACT
GAGGGCAGGGCAGGGCCTGGAGGGCAGTGTCTCTGTCAATGAAGTCTCCTTGCCTGTCAATCTCACCAAG
ACCTGCCTCCCTCCAGCAGCCTTAGAGAGGGAGGAGGAGGTGCATCCACGTGCGAGTAGCCTGTGCTAGG
CTTGCAGAATCCCCAGTTTCCAAATCAACATCTCCTTCCTTTCCAGTATAGCCAAGGTTCACGATTTGGA
GTCAGATGTGGATTCAGATTCTGGCTCCACCACTTACTGACTGTGTGACCTGAGACTAGTTACTTAATCT
CTCTGTGCTTCAGTTTTTCCATGGAAAAGATGGGGATCGTGTTATCTCCTGTACAGGTGGCTGTGAGGAT
GATGATAAGCTCTACAAAGTGCTTAGTACCGGGCCAGGTGCCTGGTAAAGGTAACTAACATCTTCCAATC
CTGCCCCAGTGGAGCAGCTTAGAGACATAGGAAGTATCTGGTAAGGTTGGAGAGGTCAGAGGGGAGTCCA
TTCCTGGGCCTTCTAGCTCAGGACACCAGGGCATGTGGGTGGCAGACAGGAGCATCCTCTGCAAGGAGGC
TGCCCATAGATCACACATGTCCCAGTGGCATGTCACATCCAGACATGCCACTGGGAAAGTCCCTGGTGTC
TACTAATTCCTTCAGAAATGTTAGTTCCTGTCCCATGCCCTTAATATTTCCCATGGCGCCTGCTTTCCTG
GGCTCTAAAACTGGCTGCTCCTCCTGACACTGAGTAGGACCTCCAACTCTTACAGATCCCTTCCCCTGAA
GTATTTGAAGAGCTGATCAAGTTTTCCTTCCACACTAACGTGCTTGAGGACAACATTGGCTACTTGAGGT
TTGACATGTTTGGGGACGGTGAGCTGCTCACCCAGGTCTCCAGGCTGCTGGTGGAGCACATCTGGAAGAA
GATCATGCACACGGATGCCATGATCATCGACATGAGGTCAGTGGCCAGGGGTCAGTGCTTCCTAGCCAGG
ACGCAGGGCTGCCAGGGGACAGTCAAAGCTATGGGCCACAGCAGGGAAGAAAAGGAACCCTGTGACACAG
CAGAGGACCTGAGGGGGGCCAGGCCTCCTGCCTATCAGGGCTTCGGCCAGCTAGCCCAGCAGATCTGCTG
TCATTGCAGGTGGGGCCCAGCACTGGTAGTTTTTGCAAGCTTCTCCAGTGATTCCAATGTGCATTCCAGA
TTGAGAATTACCCCAGATTTGCCTGGTCATAGGATTCAGTGGGGAGGAGAGGAAGGAGATGTTAAAAACA
CTGATTCCTGGGCCCCACTCCCCTCTTACTGACTCAGAAGCTCCAGGGGACAGGCCCGATAATCTCTATT
TGACAGGCATCCCAGGTGATTCTGATGGTCAGTGGTGTGTGAGACAGCCAGGCCCCCCACCTGGGAGTGT
GCCTCACATCATACAAAATCAACACATGACAACCCTGGTCATATGAATCGTACAGGCAGAATTTGGAAAT
CACACAGGGAAAATTTAGAAGTTAATCACTATTGTTAACAAAAGAATTCTTTGCATCACCAAATGATTGT
CAGAAGGATGTCTTCAGCTAGCCACCTCCCCTCTGTTTCTGTAAAAATGTGCCTCATATGTCATGAGTTT
ACCTCATGGACCAGGGGTAGGAGGTGGATGAGTACCCTCAGGCAGTGGCCAGACCTGGCATCCCATGACT
CTGGGGTCCATTGGTGGACATGCCCCAGCACCCTCCCTGGGCAGGTTGCCTTCCTCAGACGGGACCCTTC
CATGCTCCCGTGTTGTCTGAAAGAAGTGGCAGGGGGTGGCAGACCAGAAGCATTCACCCAGCTCCAGTTC
TCTAGCCCTCAGCGCTCACTCACATGGTTCTTAGTGGTCACTAGGTGGCTCTCGGTCCTGCACCCACTGC
TTCTCCTCCCTGGGAGATAAAACATTAGCCCTGGCTCCAGTTCTGTGTGTGTTCACAGCCTGAGCTTGAG
GCTCCTGGGGTCTCTCTGATCATTTTATTCTTTAGAAGTTCTGTTGAGCACCCAAATGACACTCATGCTA
AGTCTCTTTCTTCTGAATATGCCATTTACACTTTTTAAAGAGGAGATGGCCCCAGCCTGCAAGTGCACTT
TGCTTAAAGACCCTCCCACCCCTGAGGTTTGTTTGGAGGTTCAGACACTGACATCACAGGCCCCGAACCC
AGCCAGGCCATCCCAGGCCATCAGTTGGACGAGGCTCCTTAACACATCACTAGCCCCAGTGGGGAGACAG
GGGCCCAACGAGGTCACACAGTGGGACAAATCTAAATGGCCTGGGAGAAATACAGGCTCCCCTGCTCCCA
ATGCAGCTCCACAAGCCTGAATATTTCAATACACTAAGTGCCCTGTTAAGACACCTGAACTAAGACAGCT
GGTAGGTGTCATAAGATTGTCACAGAATGCAACGGGAAAAACAATGTTTCCCAAAATGTGTTCCACTCAT
AGGAAGATATGGGTGCAGGGGAGCAGTCCATGGTCAATAAATGGGGGAAATTTATCAACAAGTTTCTGAC
TGCAGGACTTGTCAGGGCCTTTAATATATTAACATGTATTAATTACATAGCAGAAGGAAAGGATAACATA
TTTGATCACTAAGTTTCTTGTTCTAAAGAGACTAGTACTCTTGGAAATACTCTGGAAAATGCCAACCCAT
GGAATTCTAAAGGAGGAAGAGGCACTAGACTGAGGCTGCCAAGAATTAGAACCCTCCATGGGACAAAGAT
CCTGGCCTCCCCGAGGGGCACACAGGGCCTCACTGTGAGCTCAGCCCCTGAACAGGCTCTGCTTCCCATC
CTTCAGGTTCAACATCGGTGGCCCCACATCCTCCATTCCCATCTTGTGCTCCTACTTCTTTGATGAAGGC
CCTCCAGTTCTGCTGGACAAGATCTACAGCCGGCCTGATGACTCTGTCAGTGAACTCTGGACACACGCCC
AGGTTGTAGGTACGTGGAGAAGCTTTCTCCTTTCTGCTGTCATTCTAGAAGCTTCTGGGAAACCAGGGAA
AGACAGCTTGGGTGTAGGTAAAAGTCATAGTAACCAGAATGTAAGGCCCTGTCCTAGTCCAGGCACTAGA
TGTGCATGATCTCGAATCCCTGAAAAGCATGTATCACTATGCCCGTTTTCTAGAGGAAAAAAAAGGGGGT
GTTGACTAGGTCAAATATCTTTTCTAGGGTCATGCAGCTAATAAGTGAAACCCAAAATGTGAATATTAGT
TTGTCTAATACCAAAATTTCCCCCAGGCTTAGCACCATAATCACCAGCCTGCAGGACAAATGCAGAATTT
GAAGGATTCTCCCCGCCCCTCACCAACCCCAGTGGGCATTGCCAGTGCTCACAGTACTTGAGCTCTCAAG
CCACAGTGCCACAAACTTGCCTGGAAAGGTCATGATGCTGATCGGGCTTCTGTTCCCCGCCCTGGGCCCA
GAGCAGTGGCTATAGGAGCAAAGGCAGGCCCTGAGCTTTACAGAACCATAACTCTCAAAGCCCCATTCCA
GGGTGGATGGCCTCCATCTATCTTCCCTGCCCAGTGTGTAAGACCAAGGAACTTGTGCTCCTACCCAACA
AGAAAGGACTGGAGAGACCGATGGGGGTGTGCCTGTGACCAGAGAAACACCCCACCATTTTCATGTCCAT
GCTTCTGTAATACACAGGCATTTTGCTGTAGCTCCTAGGACATACGTTCAATAATATTACAAGTGTAAAT
GCAAATCAGAACCAGGTGAATTCTAAATTCAAATAGATGTTCAAGACTGGAAGTTAAAGATAGACTCAAT
TCTGCAGATAATGAGGCCCCAAAACCGCAAGGTCCAATATGGGAGCCACAAGCCACCTGCGGCCACCAAG
CATTTGAAATGTGGCTCTCCCAAGTTGAGATGTGCTGGAAGTGTGATGTGCTGGAAGTGTAATGTGCATA
CCAGATTTTGAAGACATTATGAAAAGAAAACCTCATTAATAATTTTATTTGATTACATTTTGAAAAGAAT
GTATTTTGGATACATTGGCTTAAACAAAACATGATTAAAATTAACACCATGGGTTTCTTTTTGCTTGCTT
AACATGGCTACTAGGGAACCTAAAATGACATCTATGGCCAGCATTCTGGCTCACGTTGCATTCCTGTTGG
ACAGTGCTGTCCTGGAGAGTTGTTCTTATACATCACAAATTGGGCTTTTCTGAGTCCAAAGTGAAAAGGA
AGTCAGGTCGGTTTAGGTGTTCTCATTATTCATGAAGAGAGAGGATGCTCCTTTCTCAGGAGAGTCAAGC
CTTTCCTATCACTTGGCATAAAAAGGCCTCGTTGGGAGTTGTCAAGCACTGAAATCCTCGTGATTGGGCA
TGCATTCTTGTCCCCATTTTACGGATGCAGAAATCAAGGCTCAGAGAAGTCAAGTGGCTCACAAGTGGAC
ACAAGGACACAGACCTAAACCCCCGGGCCTCCTCCATCACTGCAGGCCCAGGCAGGATAGAGAAGACAGG
TGCTCCAGGGTCCTGACATGACCCCCATCCTGAAGGGCCTTATGTCTTCCAGGTGAACGCTATGGCTCCA
AGAAGAGCATGGTCATTCTGACCAGCAGTGTGACGGCCGGCACCGCGGAGGAGTTCACCTATATCATGAA
GAGGCTGGGCCGGGCCCTGGTCATTGGGGAGGTGACCAGTGGGGGCTGCCAGCCACCACAGACCTACCAC
GTGGATGACACCAACCTCTACCTCACTATCCCCACGGCCCGTTCTGTGGGGGCCTCGGATGGCAGCTCCT
GGGAAGGGGTGGGGGTGACACCCCATGTGGTTGTCCCTGCAGAAGAGGCTCTCGCCAGGGCCAAGGAGAT
GCTCCAGCACAACCAGCTGAGGGTGAAGCGGAGCCCAGGCCTGCAGGACCACCTGTAGGGAAGGGCCCCA
TAGGCAGAGCCCCAGGGCAGACAGAACCTCTGGGACACACACCAAGGGCACTCCTGCAGGTGGCCCGGCC
TGAGGTTCCCAGGAGCAGCAAAGGGGCCTGCTGAGCTCTGGTTAGGTTACAGCTGGAGGTGTGTATATAT
ACACACACACACATGTATATACACATATATATGTGTATGTATATATATGTATATATATATGGCTTTCCAA
TAACCACCTAAATTTTAACAAAGGTTCCTTCTAAGTGGTAGAACTTGGGGTGGTATTTTTACCTTCCTTC
TTCATACTTTGCTCTTTTTCTTAAATACTCATTAATGTGCATATATCATTATTTTCAGATGCAGCTATCA
TTATTCCAAAATACAAAATAAAGAAGATAAAATAAATTATATACCCGAGCCATTA

Protein Sequence
>NP_002891.1 retinol-binding protein 3 precursor [Homo sapiens]
MMREWVLLMSVLLCGLAGPTHLFQPSLVLDMAKVLLDNYCFPENLLGMQEAIQQAIKSHEILSISDPQTL
ASVLTAGVQSSLNDPRLVISYEPSTPEPPPQVPALTSLSEEELLAWLQRGLRHEVLEGNVGYLRVDSVPG
QEVLSMMGEFLVAHVWGNLMGTSALVLDLRHCTGGQVSGIPYIISYLHPGNTILHVDTIYNRPSNTTTEI
WTLPQVLGERYGADKDVVVLTSSQTRGVAEDIAHILKQMRRAIVVGERTGGGALDLRKLRIGESDFFFTV
PVSRSLGPLGGGSQTWEGSGVLPCVGTPAEQALEKALAILTLRSALPGVVHCLQEVLKDYYTLVDRVPTL
LQHLASMDFSTVVSEEDLVTKLNAGLQAASEDPRLLVRAIGPTETPSWPAPDAAAEDSPGVAPELPEDEA
IRQALVDSVFQVSVLPGNVGYLRFDSFADASVLGVLAPYVLRQVWEPLQDTEHLIMDLRHNPGGPSSAVP
LLLSYFQGPEAGPVHLFTTYDRRTNITQEHFSHMELPGPRYSTQRGVYLLTSHRTATAAEEFAFLMQSLG
WATLVGEITAGNLLHTRTVPLLDTPEGSLALTVPVLTFIDNHGEAWLGGGVVPDAIVLAEEALDKAQEVL
EFHQSLGALVEGTGHLLEAHYARPEVVGQTSALLRAKLAQGAYRTAVDLESLASQLTADLQEVSGDHRLL
VFHSPGELVVEEAPPPPPAVPSPEELTYLIEALFKTEVLPGQLGYLRFDAMAELETVKAVGPQLVRLVWQ
QLVDTAALVIDLRYNPGSYSTAIPLLCSYFFEAEPRQHLYSVFDRATSKVTEVWTLPQVAGQRYGSHKDL
YILMSHTSGSAAEAFAHTMQDLQRATVIGEPTAGGALSVGIYQVGSSPLYASMPTQMAMSATTGKAWDLA
GVEPDITVPMSEALSIAQDIVALRAKVPTVLQTAGKLVADNYASAELGAKMATKLSGLQSRYSRVTSEVA
LAEILGADLQMLSGDPHLKAAHIPENAKDRIPGIVPMQIPSPEVFEELIKFSFHTNVLEDNIGYLRFDMF
GDGELLTQVSRLLVEHIWKKIMHTDAMIIDMRFNIGGPTSSIPILCSYFFDEGPPVLLDKIYSRPDDSVS
ELWTHAQVVGERYGSKKSMVILTSSVTAGTAEEFTYIMKRLGRALVIGEVTSGGCQPPQTYHVDDTNLYL
TIPTARSVGASDGSSWEGVGVTPHVVVPAEEALARAKEMLQHNQLRVKRSPGLQDHL

Molecule Role Protective antigen
Related Vaccines(s) EAU DNA vaccine IRBP-DNA encoding IRBP
References