VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Cov19VaxKB
Vaccine Mechanisms
VaximmutorDB
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign2
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

spaA

Gene Name spaA
Sequence Strain (Species/Organism) Erysipelothrix rhusiopathiae
NCBI Protein GI 5881768
Taxonomy ID 1648
Gene Strand (Orientation) ?
Protein pI 4.96
Protein Weight 40057.21
Protein Length 426
Protein Sequence
>BAA84455.1 spaA, partial [Erysipelothrix rhusiopathiae]
INEPKGYQSFEAVNEEINSIVSELKHEGMSLQNIHHMFKQSIQNLATRIGYRSFMQDAMYLENFERLTIP
ELDEAYVDLLVNYEVKHRILVKYEDKVKGRAPLEAFIVPLRNRIRSMNEIAAEVNYLPEAHEDFLVSDSS
EYNDKLNNINFALGLGVSEFIDYNRLENMMEKEIHPLYLELYAMRRNRQIQVVRDVYPNLERANAVVESL
KTIKDIKQREKKLQELLEIYIQRSGDVRKPDVLQRFIGKYQSVVDEEKNKLQDYLESDIFDSYSVDGEKI
RNKEITLINRDAYLSMIYRAQSISEIKTIRADLESLVKSFQNEESDSKVEPESPVKVEKPVDKEKPKDQK
KPVDQSKPESNS

Molecule Role Protective antigen
Related Vaccines(s) E. rhusiopathiae DNA vaccine pcD-ACSC
References