VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

BAB1_0278

Gene Name BAB1_0278
Sequence Strain (Species/Organism) Brucella melitensis biovar Abortus 2308
NCBI Protein GI 82615279
Other Database IDs CDD:264424
EnsemblGenomes-Gn:BAB1_0278
EnsemblGenomes-Tr:CAJ10234
InterPro: IPR011681
UniProtKB/TrEMBL: Q2YPC5
Taxonomy ID 359391
Gene Strand (Orientation) ?
Protein Name conserved hypothetical protein
Protein pI 8.51
Protein Weight 8787.28
Protein Length 148
Protein Note GcrA cell cycle regulator; cl11564
Protein Sequence
>CAJ10234.1 conserved hypothetical protein [Brucella abortus 2308]
MHWKSRSPLSEALPMFDKLTSPHEGFRLADLSRRQCKWPVNRAQAGELHLFCGEAVQNGHPYCEEHCGKA
YTGKAGSR

Molecule Role Protective antigen
Related Vaccines(s) B. abortus DNA vaccine pVF278
References