VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

N nucleocapsid protein

Gene Name N nucleocapsid protein
Sequence Strain (Species/Organism) Hirame novirhabdovirus
NCBI Gene ID 2559538
NCBI Protein GI 34610115
Locus Tag HIRRVgp1
Genbank Accession AF104985
Protein Accession NP_919030
Taxonomy ID 1980915
Gene Starting Position 166
Gene Ending Position 1344
Gene Strand (Orientation) ?
Protein Name nucleocapsid protein
Protein pI 4.48
Protein Weight 39984.35
Protein Length 392
DNA Sequence
>NC_005093.1:166-1344 Hirame rhabdovirus, complete genome
TATGGCGAACCTTAAGGAAGAATTTGCAGGACTCCGAGGAGTGAAGGGAGGAGCCCTCGAAGACTCTGGC
ACGGAGTATGATCCCACCAAGATCAACCTGACGCTCTACGGGACAGACAAGCTCTATACCCTGGCGATCA
TCAAGAGGGCAGTCAGTCAGGTCGGAGGGTCCCAAACCAACAAAGCACTAGGAATCCTTTGTGCTTTTGT
CACGTCAGAGAACAACCCTGACATGACAGATGCAGCAGTCAAGCTCCTGGTGGACATGAGGTTCAAGGTG
GACGTGGTGCCCGTGGACGACAGGCTCGGTGACAATCTGGATGACCCCAACTCAAAGCTGGCGGAGGTCC
TGACGGAAGAGAACATGGTGGACCTGGTGAAAGGCCTTCTGTTCACTTGTGCCCTGATGGTCAAGTACGA
TGTGGACAAGATGGCCACATACTGCCAGCAGAAGCTGGAGCGACTGGCCAACAGTCAGGGACTCAACGAG
CTGACCCTGATAAGCACGAGTAGGGCAGTTCTGGCTCGGATTGGGGCAGCGGTAAGACCGGGGCAGAAGT
TAACCAAGGCCATCTACGGGATCATTCTTATCAACCTGATGGATCCCGCCACTGCTGCCAGGGCAAAGGC
CCTTTGTGCCATGAGGCTGAGCGGAACCGGAATGACCATGGTGGGTCTATTCAATCAGGCCTCTAAGAAC
CTTGGAGCTCCACCTGCAGATCTGCTGGAAGATCTCTGCATGAAGTCCATCATCGACTCTGCCAGGAGGA
TTGTCAAGCTGATGAGGATCGTTGCAGACGTCGAGGACATGACCGCAAAGTATGCCATCATGATGAGCAG
GATGCTTGGGGATGGGTACTTCAAGTCCTACGGGATCAATGAGAACTCACGGATCACCTGTATCTTGATG
AACATCAACGAGCAGTACGATGAGGGGACAACCGGAGGACTGGCAGGAGTCAGGGTTTCACCCCCCTTCC
GAAAGCTGGCAACCGAGATTGCTCGCCTTCTGGTCAAAAAGTATGACGGGAACGGATCTGCCGGGCCAGG
TGCCTCAGATCTTGTCCGCCAGGCCGAGCAGGCAGCGCAAGAGACCGAGGGCGAGGATGATAAGTACGAT
GAGGAGGGCGAGGAAGACGGAGGGGAGGGAGAGGGGGGAGAGGACGAAGAGTACTACTG

Protein Sequence
>NP_919030.1 nucleocapsid protein [Hirame novirhabdovirus]
MANLKEEFAGLRGVKGGALEDSGTEYDPTKINLTLYGTDKLYTLAIIKRAVSQVGGSQTNKALGILCAFV
TSENNPDMTDAAVKLLVDMRFKVDVVPVDDRLGDNLDDPNSKLAEVLTEENMVDLVKGLLFTCALMVKYD
VDKMATYCQQKLERLANSQGLNELTLISTSRAVLARIGAAVRPGQKLTKAIYGIILINLMDPATAARAKA
LCAMRLSGTGMTMVGLFNQASKNLGAPPADLLEDLCMKSIIDSARRIVKLMRIVADVEDMTAKYAIMMSR
MLGDGYFKSYGINENSRITCILMNINEQYDEGTTGGLAGVRVSPPFRKLATEIARLLVKKYDGNGSAGPG
ASDLVRQAEQAAQETEGEDDKYDEEGEEDGGEGEGGEDEEYY

Molecule Role Protective antigen
Related Vaccines(s) H. rhabdovirus DNA Vaccine encoding N and G
References