VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

G glycoprotein

Gene Name G glycoprotein
Sequence Strain (Species/Organism) Hirame novirhabdovirus
NCBI Gene ID 2559534
NCBI Protein GI 34610118
Locus Tag HIRRVgp4
Genbank Accession AF104985
Protein Accession NP_919033
Taxonomy ID 1980915
Gene Starting Position 2923
Gene Ending Position 4449
Gene Strand (Orientation) ?
Protein Name glycoprotein
Protein pI 6.67
Protein Weight 53029.85
Protein Length 508
DNA Sequence
>NC_005093.1:2923-4449 Hirame rhabdovirus, complete genome
CATGGACCCTCGAATAATGTATTACACTGTTCTCCTCACGACAGCTGCCAGAGTCTATGGTCAAACCATC
AAGCCTGGAGTTGACAGCGTATCCGATCAACCCACCTGGGCGAATCCCCTGTTTACATACCCTGTGGACT
GTCCTGCGGCTAAGCTATCCAAGGTGAGTCCCTCACAGTTGAGGTGCCCACGCATATTTGATGATGAAAA
CCGAGGACTCGTTGCCTACCCTGCTGTCATCAGATCCCTATCGGTAGGGAACAATCTTGGGGACATTCAT
ACTCAGGGGGAATACGTCCACAAGGTCCTTTACCGAACCACATGTTCAACAGGGTTCTTTGGGGGCCAAA
CCATAGAGAAGGCCCTAGTAGAGATGAAACTGGCCCCCAGGGAGGTGGGAGTGTATGACACCACGACAGC
CTCAGCACTGTACTTCCCAGCTCCAAGGTGCCAATGGTACACGGACAATGTACATAACGACCTGACATTC
TACTATACGACCGCCAAGAGTGTCCTTAGAGATCCTTACACCCTGGGATTCCTTGATTCTGATTTTATTG
AAGGGAAGTGCTCCAAGTCGCCGTGTCAGACCCATTGGTCAAATGTGGTGTGGAAGGGAGACTCGGGAGT
TGCCGCCTGTGACACGGGGTCTGAGATAAAGGGTCACATATTTGTGGACAAGACCTCCCACCATGTCGTC
AAGGCAACGAGCTATGGACACCACCCATGGGGACTTCATCGAGCTTGCATGATTACCTTCTGTGGAAAAC
CATGGATCAGGACAGACCTAGGGGACCTCATCGCAATCGAATACAATGGCGGGGCGACCCTTCTCGCATT
CCCTGCTTGCAAGGACACCACGGTTGGAATGAGAGGGAGTCTTGACGACTTTGCCTACTTGGATGATCTG
GTGAAGTCATCTGAAAGTCGGGAGGAATGTCTAGAGGCACATGCGGAGATCATCGCTACCAATAGTGTGA
CTCCTTACCTGCTATCCAAATTCAGATCTCCCCACCCAGGAATAAACGATGTCTACGCCATGCATGACGG
GTCCATATACCACGGAAAGTGCATGACCGTTGCCATTGATGAGGTTTCCAAAGATAGACGAACTTATCGT
GCCCACCAGACCTCAGCTTTCGTAGCATGGGGGCATCCCTTCGGTGATGAATGGGGCGGGTTTCACGGTC
TTCATGGCAACGATACTCCTGTGATTCCGGATCTTGAGAAATACGTCGCTCAGTACAAGGTGAGCATGAT
GGACAAGATGGACATTCGCCCCGTTCCGCATCCTAGTGTCCAGATACTCTACAACGACACAGACACCGCA
GACATCACAATCAGGAAGATAGACTCGTTTGATCTGCAATCACTCAACTGGAGCTTCTGGCCATCATTGT
CAGCACTGGGAGGGGTTCCAATACTCCTCGCCCTCGTATTCTTTCTGTACTGCTGCATGAACAGAAGACC
CTCCATGCCTGCAGCACCCCAAGAGATCCCCATGTACCACCTCGCCAGTCGAGGGTA

Protein Sequence
>NP_919033.1 glycoprotein [Hirame novirhabdovirus]
MDPRIMYYTVLLTTAARVYGQTIKPGVDSVSDQPTWANPLFTYPVDCPAAKLSKVSPSQLRCPRIFDDEN
RGLVAYPAVIRSLSVGNNLGDIHTQGEYVHKVLYRTTCSTGFFGGQTIEKALVEMKLAPREVGVYDTTTA
SALYFPAPRCQWYTDNVHNDLTFYYTTAKSVLRDPYTLGFLDSDFIEGKCSKSPCQTHWSNVVWKGDSGV
AACDTGSEIKGHIFVDKTSHHVVKATSYGHHPWGLHRACMITFCGKPWIRTDLGDLIAIEYNGGATLLAF
PACKDTTVGMRGSLDDFAYLDDLVKSSESREECLEAHAEIIATNSVTPYLLSKFRSPHPGINDVYAMHDG
SIYHGKCMTVAIDEVSKDRRTYRAHQTSAFVAWGHPFGDEWGGFHGLHGNDTPVIPDLEKYVAQYKVSMM
DKMDIRPVPHPSVQILYNDTDTADITIRKIDSFDLQSLNWSFWPSLSALGGVPILLALVFFLYCCMNRRP
SMPAAPQEIPMYHLASRG

Molecule Role Protective antigen
Related Vaccines(s) H. rhabdovirus DNA Vaccine encoding G , H. rhabdovirus DNA Vaccine encoding N and G , H. rhabdovirus DNA vaccine pHRV-G encoding HIRRV and VHSV G proteins
References