VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

pilA

Gene Name pilA
Sequence Strain (Species/Organism) Pseudomonas aeruginosa PAO1
NCBI Protein GI 15599721
Other Database IDs CDD:227304
Taxonomy ID 208964
Gene Strand (Orientation) ?
Protein Name type 4 fimbrial protein PilA
Protein pI 6.59
Protein Weight 15164.05
Protein Length 225
Protein Note Tfp pilus assembly protein, major pilin PilA [Cell motility, Extracellular structures]; COG4969
Protein Sequence
>NP_253215.1 type 4 fimbrial protein PilA [Pseudomonas aeruginosa PAO1]
MKAQKGFTLIELMIVVAIIGILAAIAIPQYQNYVARSEGASALATINPLKTTVEESLSRGIAGSKIKIGT
TASTATETYVGVEPDANKLGVIAVAIEDSGAGDITFTFQTGTSSPKNATKVITLNRTADGVWACKSTQDP
MFTPKGCDN

Molecule Role Protective antigen
Related Vaccines(s) P. aeruginosa DNA vaccine pGACAG-OprF/OprI + pGACAG-PcrV + pGACAG-PilA
References