VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

BCSP31

Gene Name BCSP31
Sequence Strain (Species/Organism) Brucella abortus
NCBI Nucleotide GI 144104
NCBI Protein GI 144105
Protein Accession AAA22993.1
Other Database IDs CDD:273982
Taxonomy ID 235
Gene Strand (Orientation) ?
Protein Name cell surface protein
Protein pI 7.77
Protein Weight 32204.04
Protein Length 397
Protein Note biovar Abortus
DNA Sequence
>gi|144104|gb|M20404.1|BRUBCSP B.abortus BCSP31 gene encoding a 31-KDa cell surface protein, complete cds
GCGCCTATACGCGCGACCTGATCCAGTCTTTTGCATCGCGGTGCCATGTGCGTCTGGTGGGGGCCGACGG
GCTGGCGGCGATTGCCGAAGCGCATATTCGCGGTGAAAGTTTCGATGAGGCGCTGGTCATGGCGCAGATC
GCGCCATGTTTTATCGAAAAGGATGGCAAGCGCACCGATATCGTGGTGCTTGCCTGTACGCATTATCCGT
TTCTCGTCAATGTATTGCGCCGTCTGGCTCCATGGCCGGTGGATTGGCTGGACCCGGCGGAAGCCATTGC
ACGACGCATGAAATCGCTTTTGCCTGCGCGAAGTGACGATGATGAATTTCATTCTCAAGATGACCTAGCA
TTCTTCACATCCAGGAAACCCGACTATGCCATTCGCCGCCTGATGCAGGGTTTTGGGCTGCGTTTTTAAT
CGTTTCAGTCGGCTCTGGCGGCGCTTGTCGGCAAGCGATTGTATTCTTTGGGAAAATCCAGAATAATGGA
ATGCGGTGGTTGACAATCGGCCTCAAGCTTCCTATGGTTTTCGGCATAATCTATGCGGGAAGAGGACTGG
TATTATGAAATTCGGAAGCAAAATCCGTCGCTTGGCTGTTGCGGCGGTGGCGGGCGCGATTGCGTTGGGA
GCGAGCTTTGCGGTTGCACAGGCCCCGACATTTTTCCGTATCGGCACTGGCGGCACAGCCGGAACCTATT
ATCCGATTGGTGGTCTGATCGCGAACGCGATTTCCGGCGCAGGCGAAAAGGGCGTGCCGGGTCTCGTCGC
GACGGCCGTTTCGTCGAATGGCTCGGTTGCCAATATCAATGCGATCAAGTCGGGCGCTCTGGAGTCCGGC
TTTACGCAGTCAGACGTTGCCTATTGGGCCTATAACGGCACCGGCCTTTATGATGGCAAGGGCAAGGTGG
AAGATTTGCGCCTTCTGGCGACGCTTTACCCGGAAACGATCCATATCGTTGCGCGTAAGGATGCAAACAT
CAAATCGGTCGCAGACCTGAAAGGCAAGCGCGTTTCGCTGGATGAGCCGGGTTCTGGCACCATCGTCGAT
GCGCGTATCGTTCTTGAAGCCTACGGCCTCACGGAAGACGATATCAAGGCTGAACACCTGAAGCCGGGAC
CGGCAGGCGAGAGGCTGAAAGATGGTGCGCTGGACGCCTATTTCTTTGTGGGCGGCTATCCGACGGGCGC
AATCTCGGAACTGGCCATCTCGAACGGTATTTCGCTCGTTCCGATCTCCGGGCCGGAAGCGGACAAGATT
CTGGAGAAATATTCCTTCTTCTCGAAGGATGTGGTTCCTGCCGGAGCCTATAAGGACGTGGCGGAAACAC
CGACCCTTGCCGTTGCCGCACAGTGGGTGACGAGCGCCAAGCAGCCGGACGACCTCATCTATAACATCAC
CAAGGTTCTCTGGAACGAGGATACACGCAAGGCACTCGATGCGGGCCATGCGAAGGGCAAGCTCATCAAG
CTCGATAGTGCGACGAGCAGCCTCGGTATTCCGCTGCATCCCGGCGCAGAACGCTTTTACAAGGAAGCGG
GCGTGCTGAAATAATCCCTCAATGATCGGTTCCTGATATCTTATTCCGAATTGAAGGGTGACATTGCGGC
AGCTCGTTATGCGCGCTGCTGCGCTCCCGTTTTCCAGAGCGGTTCCGGTTAGAACGGAATCGTTGGAACC
GCTCTATCTCTTTGTTTTTACGCATTATCCGACGCAAAACCGTTTCACGCTTTTGCTGGAAATGCTCTAG
CCTATTGAAATGCACGACCGGCAAAGTGGAGTTGGCCCGCATGACAGAAGAACAAAATGCAAAGCTT
Protein Sequence
>AAA22993.1 cell surface protein precursor [Brucella abortus]
MKFGSKIRRLAVAAVAGAIALGASFAVAQAPTFFRIGTGGTAGTYYPIGGLIANAISGAGEKGVPGLVAT
AVSSNGSVANINAIKSGALESGFTQSDVAYWAYNGTGLYDGKGKVEDLRLLATLYPETIHIVARKDANIK
SVADLKGKRVSLDEPGSGTIVDARIVLEAYGLTEDDIKAEHLKPGPAGERLKDGALDAYFFVGGYPTGAI
SELAISNGISLVPISGPEADKILEKYSFFSKDVVPAGAYKDVAETPTLAVAAQWVTSAKQPDDLIYNITK
VLWNEDTRKALDAGHAKGKLIKLDSATSSLGIPLHPGAERFYKEAGVLK

Molecule Role Protective antigen
Related Vaccines(s) B. abortus DNA vaccine expressing BCSP31, SOD and L7/L12
References