VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

L7/L12

Gene Name L7/L12
Sequence Strain (Species/Organism) Brucella abortus RB51-AHVLA
NCBI Protein GI 479804332
Other Database IDs CDD:100102
Taxonomy ID 1198700
Gene Strand (Orientation) ?
Protein Name 50S ribosomal protein L7/L12
Protein pI 4.62
Protein Weight 12562.32
Protein Length 198
Protein Note vaccine strain
Protein Sequence
>ENT73302.1 50S ribosomal protein L7/L12 [Brucella abortus RB51-AHVLA]
MADLAKIVEDLSALTVLEAAELSKLLEEKWGVSAAAPVAVAAAGGAAPAAAAEEKTEFDVVLADGGANKI
NVIKEVRALTGLGLKEAKDLVEGAPKAVKEGASKDEAEKIKAQLEAAGAKVELK

Molecule Role Protective antigen
Related Vaccines(s) Divalent DNA B. abortus Vaccine pcDNA3.1-L7/L12-Omp16
References