VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

omp16

Gene Name omp16
Sequence Strain (Species/Organism) Brucella abortus RB51-AHVLA
NCBI Protein GI 479804733
Other Database IDs CDD:225439
CDD:143586
Taxonomy ID 1198700
Gene Strand (Orientation) ?
Protein Name outer membrane lipoprotein omp16
Protein pI 10.24
Protein Weight 18331.05
Protein Length 247
Protein Note vaccine strain
Protein Sequence
>ENT73703.1 outer membrane lipoprotein omp16 [Brucella abortus RB51-AHVLA]
MRRIQSIARSPIAIALFMSLAVAGCASKKNLPNNAGDLGLGAGAATPGSSQDFTVNVGDRIFFDLDSSLI
RADAQQTLSKQAQWLQRYPQYSITIEGHADERGTREYNLALGQRRAAATRDFLASRGVPTNRMRTISYGN
ERPVAVCDADTCWSQNRRAVTVLNGAGR

Molecule Role Protective antigen
Related Vaccines(s) Divalent DNA B. abortus Vaccine pcDNA3.1-L7/L12-Omp16
References