VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

env

Gene Name env
Sequence Strain (Species/Organism) Simian-Human immunodeficiency virus strain SHIV89.6P
NCBI Protein GI 72398919
Other Database IDs CDD:278917
Taxonomy ID 57667
Gene Strand (Orientation) ?
Protein Name envelope protein
Protein pI 9.92
Protein Weight 40473.44
Protein Length 461
Protein Note Envelope glycoprotein GP120; pfam00516
Protein Sequence
>AAZ72871.1 envelope protein, partial [Simian-Human immunodeficiency virus]
LNCTNLNITKNTTNPTSSSWGMMEEGEIKNCSFYITTSIRDKVKKEYALFNRLDVVPVENTSYRLISCNT
SVITQACPKVSFQPIPIHYCVPAGFAILKCNNKTFNGSGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEE
DIVIRSENFTNNVKNIIVQLNESVVINCTRPNNNTRERLSIGPGRAFYARRNIIGDIRQAHCNISRAKWN
NTLQQIVIKLREKYRNKTIAFNQSSGGDPEIVMHSFNCGGEFFYCNTAQLFNSTWNVTGGTNGTKGSDII
TLQCRIKQIINMWQKVGKAMYAPPIKGQIRCSSNITGLLLTRDGGSSTETEPEIFRPGGGDMRDNWRSEL
YKYKVVRIEPIGVAPTRAKRRTVQREKR

Molecule Role Protective antigen
Related Vaccines(s) DNA and poxvirus priming-boosting SHIV vaccine , HIV DNA vaccine SIVmac239 Gag-Pol-Nef and mock Env with rAd5 boost
References