VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

p1

Gene Name p1
Sequence Strain (Species/Organism) Coxiella burnetii
VO ID VO_0010930
NCBI Protein GI ACJ19787
Locus Tag AY249911
Other Database IDs ncbi protein accession number: AAP04425.1
Taxonomy ID 434924
Gene Strand (Orientation) ?
Protein Name outer membrane porin P1
Protein pI 7.87
Protein Weight 25162.44
Protein Length 321
Protein Note phase I
DNA Sequence
>gi|30025840|gb|AY249911.1| Coxiella burnetii strain Xinqiao outer membrane protein P1 gene, complete cds
ATGGAAACAACTACAAAACTCGCCATAGGCGTTTCTGCACTATGCTGCTTAGCCAGCGCTGCCTTTGCTG
GCGGTCCTGATATCCCCATGATTGATATGAATGGTTTTCATATCGGTTTGGGTTTTGGATATAAATCTTA
TACCTATGATCAGGTCGGAACCGTTACAGTTACTACTAATGGGGGCACTGTTCTGAGCGTGCTTCACCCA
GTTTCTGCTTCAATAACCCAATCTGGTCCTGTCGGTGAATTAGGTTATACCTTCGCAAGTGACTGGTGGA
TAGCAGGTGTTAAGGCTCAATACCAGTACGATAACGTACGAAGCGTCCACATAATGGATGCACCTTTAGT
AGGTTCTAATTATTCTTATCGAATCCGTTTGGGTTCCCACTTTACTGCTATGCTGTTAGCAGGTATTAAA
GTAAACGAAGCTAATGCTGTTTACTTAGAAGCCGGTTATTCGACAGTGTGGGGGAAAACTACCCTCTTTG
GTCCTGGCCCAGTTGCAGTTAGTATAAAGAATCGGCTGAACGGTGGTATCGCTGGTATCGGTTGGAGACA
TTATTTTATGAACAATGTCTTTCTTGATCTTAGCTATGACTACGCATTGTATAGAAGTAAATCCAATAGC
GTAACTCTCTCTTCAGCTACTGCTTCAGCAGAAGGGACGGCGATTGGCGTTTCAGGAACTGTTCAAAATC
CGAAACGAGTCGCAATTAACGGCATTACCGCAACCGTTAATTACCTGTTCAATATCTAA
Protein Sequence
>ACJ19787.1 outer membrane porin P1 [Coxiella burnetii CbuK_Q154]
METTTKLAIGVSALCCLASAAFAGGPDIPMIDMNGFHIGLGFGYKSYTYDQVGTVTVTTDGGTILSVLHP
VSASITQFSPVGELGYTFASDWWIAGVKAQYQYDNVRSVHIMDASLVGSTYRTRLGSHLTAMLLAGIKVN
EANAVYLEAGYSTVWGKTTLFGPGPVAVSMKNRLNGGIAGIGWRHYFMNNVFLDLSYDYALYRSKSNSVT
LSSATASAEEAAIGVLGTVQNPKRVAINGITATVNYLFNI
Molecule Role Protective antigen
Molecule Role Annotation The purified recombinant proteins, P1, HspB, and P1-HspB, and whole-cell antigen (WCA) of C. burnetii were used to immunize BALB/c mice. Protective immunity against Q fever was induced with a recombinant P1 antigen fused with HspB after Coxiella burnetii challenge (Li et al., 2005).

The identification of 37 SEPs and show that 30 react with sera from mice immunized with Cox. burnetii and sera from patients with Q fever. (Jiao et al., 2014)
Related Vaccines(s) P1-HspB (fusion of protein 1 and heat-shock protein B)
References