VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

rev

Gene Name rev
Sequence Strain (Species/Organism) Simian-Human immunodeficiency virus strain SHIV-89.6
NCBI Protein GI 2828043
Other Database IDs CDD:278833
Taxonomy ID 57667
Gene Strand (Orientation) ?
Protein Name rev
Protein pI 9.94
Protein Weight 12952.65
Protein Length 173
Protein Note REV protein (anti-repression trans-activator protein); pfam00424
Protein Sequence
>AAB99964.1 rev [Simian-Human immunodeficiency virus]
MAGRSGDSDEELIRTVRLIKLLYQSNPPPSLEGTRQARRNRRRRWRERQRQIRSISERILGTYLGRSAEP
VPLQLPPLERLTLDCNEDCGTSGTQGVGSPQILVESPTVLESGTKE

Molecule Role Protective antigen
Related Vaccines(s) HIV DNA vaccine SHIV-89.6 DNA (DNA/89.6)
References