VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

vpu

Gene Name vpu
Sequence Strain (Species/Organism) Simian-Human immunodeficiency virus strain SHIV-89.6
NCBI Protein GI 2828044
Other Database IDs CDD:109608
Taxonomy ID 57667
Gene Strand (Orientation) ?
Protein Name vpu
Protein pI 4.6
Protein Weight 8647.38
Protein Length 138
Protein Note Vpu protein; pfam00558
Protein Sequence
>AAB99965.1 vpu [Simian-Human immunodeficiency virus]
MQPIQIAIVALVVAIIIAIVVWSIVIIEYRKILRQRKIDRLIDRLIERAEDSGNESEGEISALVEMGVEM
GHHAPWDVDDL

Molecule Role Protective antigen
Related Vaccines(s) HIV DNA vaccine SHIV-89.6 DNA (DNA/89.6)
References