VIOLIN: Vaccine Investigation and Online Information Network

KMP-11
Gene Name	KMP-11
Sequence Strain (Species/Organism)	Leishmania donovani
NCBI Protein GI	34922492
Other Database IDs	CDD:281087
Taxonomy ID	5661
Gene Strand (Orientation)	?
Protein Name	Kinetoplastid membrane protein 11
Protein pI	7.89
Protein Weight	14076.21
Protein Length	246
Protein Note	KMP-11; Lipophosphoglycan-associated protein; LPGAP
Protein Sequence	>sp\|Q36736.1\|KM11_LEIDO RecName: Full=Kinetoplastid membrane protein 11; Short=KMP-11; AltName: Full=Lipophosphoglycan-associated protein; Short=LPGAP MATTYEEFSAKLDRLDQEFNRKMQEQNAKFFADKPDESTLSPEMREHYEKFERMIKEHTEKFNKKMHEHS EHFKQKFAELLEQQKAAQYPSK
Molecule Role	Protective antigen
Related Vaccines(s)	L. major DNA vaccine encoding TSA, LMSTI1, KMP11, and LACK , Leishmania major DNA vaccine KMP-11 , SL3261-L. major
References