VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

gp120

Gene Name gp120
Sequence Strain (Species/Organism) Human immunodeficiency virus 1
NCBI Protein GI 2326505
Other Database IDs CDD:278917
GOA:O40515
InterPro: IPR000777
UniProtKB/TrEMBL: O40515
Taxonomy ID 11676
Gene Strand (Orientation) ?
Protein pI 9.81
Protein Weight 11668
Protein Length 172
Protein Note Envelope glycoprotein GP120; pfam00516
Protein Sequence
>CAA74764.1 gp120, partial [Human immunodeficiency virus 1]
NGSLAEGEVVIRSENFTDNAKTIIVQLNESVVINCTRPNNNTRKNIHLGRGRSVYATEKIIGNVKQAHCN
ISRAKWNDTLKQIVEKLREQFGKNKTIVFNQSSGGDPEI

Molecule Role Protective antigen
Molecule Role Annotation he DNA construct induced a significant anti-polysaccharide antibody response that was bactericidal. Mice immunized with the DNA construct were subsequently protected against challenge with a lethal dose of N. meningitidis serogroup C.(Prinz et al., 2003)
Related Vaccines(s) N. meningitidis DNA vaccine P3A
References