VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

calpain

Gene Name calpain
Sequence Strain (Species/Organism) Schistosoma mansoni strain Puerto Rico
NCBI Protein GI 353230291
Other Database IDs CDD:279042
CDD:238004
CDD:279416
CDD:238132
CDD:290234
CDD:238008
Taxonomy ID 6183
Gene Strand (Orientation) ?
Protein Name calpain (C02 family)
Protein pI 6.64
Protein Weight 164811.89
Protein Length 1591
Protein Note Calpain family cysteine protease; pfam00648
Protein Sequence
>CCD76462.1 calpain (C02 family) [Schistosoma mansoni]
MRRKKQNSDSETECNGVPLNYLDILKPTLTEKRVQFNLNIPCSITPKGYAKLHEKLTSPCIPHSKGKADS
MADRVYRQIFLYCTNSLNGFTHSSKSETTYASPTAMRKIKISQYEIISAKMVEAKELYQDPEFPANDASI
GNLPHVSGRVEWKRPKDINPLAAFCTKSYSRFDVDQGALGDCWFASVMATVTKYPSLMSNIIPPNQTFKG
SGYTGAFVFNFWRFGEWVEVVVDDRIPVVKGTCNPVFIHSTDNSEFWSCLLEKAYAKLCGSYAHLTGGFQ
SEAMEDFTGGICTTLILNKKERPPNLLKMMEHYTKTCCVMGADVGGDKNKRREELGLIGSHAYSVTGVGK
VNYMGKDVYLVRCRNPWGERHEWKGPWSDNSPEWKDVKSKDKRALQYKPKEDGEFCSFQLTFILFISTSI
SRRNVLFGLPLFRFPSPFQVRACLVMQFGDFLNVCPIHFQQSFCTNPQYLFTIGTDNSGKVGKAHIIVGV
MQEHRRFLYGGEYLAIGFSIFEVSELQNTRLTPEELLCRKPLLTSDYIPRREVTLEADLFPGTFILIPST
YNSNQEARYICRVFSTVKMKQLELDEENSYEGFPKKELASLELNFKQLCNPVTEKINSRILGTILDQSNF
GEYMDGFTEFPSNLCSSLISSASTNLTGQIDLEEYLYLLIDLKGWMLTFNKYDDRKGCVSWFKFRDLLKS
SGYKVSNRVFSVLAHRHIDHKRGHISLESYLHCMANLKFAFDVTSYHPKSDKGILMFNKEDVYSPDENVS
GRTNRPGKEVVDPRTGRIIKVKRETPDDYLNVLKPIKGPKRMEFNPYLPKTLTPKGYAKFKLMMNVASKQ
YETLVKRLKTERTLWEDPDFPANDKAIGNLPDFRERIEWKRPHEINPNAKFFAGGASRFDIEQGALGDCW
LLAVVASISGYPQLFDQVVPKDQELKGPEYVGVVRFRFWRFGHWVEVLIDDRLPVRQGRNTLVFMHSNDP
TEFWSALLEKAYAKLNGCYAHLSGGSQSEAMEDLTGGICLSLELNQKERPSDLIDQLKIYAQRCCLMGCS
IDSSVMEQKMDNGLIGSHAYSLTGVYPVNYRGRTQWLMRLRNPWGDSHEWKGAWCDGSPQWREISEQEKK
NINLSFTADGEFWMSYEDFVTCFSRVEVCHLGLESLEYNQNFHGKRRLDEAIFSGQWQRNVNAGGCINNR
TTYWTNPQFRITVEDPDPDDDDNKCSVLIGLMQTDIRKKVGADFQPIGFMVYNAPDDLNTLLSRAQLLTR
SPIAKSQFINTREVTAQFRVPPGSYVVIPSTFDPNIEVNFILRVFSQTSITEQELDEDNTNQGLPDDVIE
ALKLEDTLLDEDQEIEQKFLAIRDPKTNAINAVKLGELLNNSTLQDIPNFQGFNKELCRSMVASVDNNLT
GHVELNEFMDLWIQAKGWKHIFIKHDVDQSGYFSAYEFREALNDAGYHVSNRLINAIINRYQDPGTDKIS
FEDFMLCMVRLKTAFETIEAHPKNIEGTSLFSAEDYLRFSVYI

Molecule Role Protective antigen
Related Vaccines(s) S. mansoni DNA vaccine Sm-p80-pcDNA3 encoding the large subunit of S. mansoni calpain
References