VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

bfrA

Gene Name bfrA
Sequence Strain (Species/Organism) Mycobacterium tuberculosis H37Rv
NCBI Gene ID 885767
NCBI Protein GI 15609013
Locus Tag Rv1876
Genbank Accession AL123456
Protein Accession NP_216392
Taxonomy ID 83332
Gene Starting Position 2125339
Gene Ending Position 2125818
Gene Strand (Orientation) +
Protein Name bacterioferritin BfrA
Protein pI 4.23
Protein Weight 17744.75
Protein Length 159
Protein Note Also known as bfr
DNA Sequence
>NC_000962.3:2125339-2125818 Mycobacterium tuberculosis H37Rv, complete genome
CATGCAAGGTGATCCCGATGTTCTGCGCCTGCTCAACGAACAATTGACCAGCGAGCTCACCGCTATCAAC
CAATACTTTCTGCACTCCAAGATGCAGGACAACTGGGGTTTTACCGAGCTGGCGGCCCACACCCGCGCGG
AGTCGTTCGACGAAATGCGGCACGCCGAGGAAATCACCGATCGCATCTTGTTGCTGGATGGTTTGCCGAA
CTACCAGCGCATCGGTTCGTTGCGTATCGGCCAGACGCTCCGCGAGCAATTTGAGGCCGATCTGGCGATC
GAATACGACGTGTTGAATCGTCTCAAGCCAGGAATCGTCATGTGCCGGGAGAAACAGGACACCACCAGCG
CCGTACTGCTGGAGAAAATCGTTGCCGACGAGGAAGAACACATCGACTACTTGGAAACGCAGCTGGAGCT
GATGGACAAGCTAGGAGAGGAGCTTTACTCGGCGCAGTGCGTCTCTCGCCCACCGACCTG

Protein Sequence
>NP_216392.1 bacterioferritin BfrA [Mycobacterium tuberculosis H37Rv]
MQGDPDVLRLLNEQLTSELTAINQYFLHSKMQDNWGFTELAAHTRAESFDEMRHAEEITDRILLLDGLPN
YQRIGSLRIGQTLREQFEADLAIEYDVLNRLKPGIVMCREKQDTTSAVLLEKIVADEEEHIDYLETQLEL
MDKLGEELYSAQCVSRPPT

Molecule Role Protective antigen
Molecule Role Annotation Mycobacterium frA (or called MMP-II) is one of the immunodominant antigens (Mukai et al., 2014).
Related Vaccines(s) BCG-DHTM
References