VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Omp31

Gene Name Omp31
Sequence Strain (Species/Organism) Brucella abortus 2308
VO ID VO_0010939
NCBI Gene ID 3788834
NCBI Protein GI 489054549
Locus Tag BAB_RS23735
Genbank Accession AM040264
Protein Accession WP_002964719
Taxonomy ID 359391
Chromosome No I
Gene Starting Position 1583642
Gene Ending Position 1584427
Gene Strand (Orientation) +
Protein Name membrane protein
Protein pI 4.74
Protein Weight 25591.47
Protein Length 261
DNA Sequence
>NC_007618.1:1583642-1584427 Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308
CATGTTTAGCTTAAAAGGGACTGTTATGAAAACCGCACTTCTTGCATCCGTCGCAATGTTGTTCACAAGC
TCGGCTATGGCTGCCGACATCATCGTTGCTGAACCGGCACCCGTTGCAGTCGACACGTTCTCTTGGACTG
GCGGCTATATTGGTATCAATGCTGGTTACGCTGGCGGCAAGTTCAAGCATCCGTTCTCAGGCATCGAGCA
GGATGGGGCCCAAGATTTTTCAGGTTCGCTCGACGTCACGGCCAGCGGCTTTGTTGGCGGCGTTCAGGCC
GGTTATAACTGGCAGCTTGCCAACGGCCTCGTGCTTGGTGGCGAAGCTGACTTCCAGGGCTCGACGGTTA
AGAGCAAGCTTGTTGACAACGGTGACCTCTCCGATATCGGCGTTGCAGGCAACCTCAGCGGCGACGAAAG
CTTCGTCCTCGAGACCAAGGTTCAGTGGTTTGGAACGGTGCGTGCGCGCCTCGGCTTCACCCCGACTGAA
CGCCTGATGGTCTATGGTACCGGTGGTTTGGCCTATGGTAAGGTCAAGACGTCGCTTAGCGCCTATGACG
ATGGTGAATCGTTCAGCGCCGGAAACTCTAAGACCAAGGCTGGCTGGACGCTTGGTGCAGGTGTAGAATA
CGCCGTCACCAACAATTGGACCCTGAAGTCGGAATACCTCTACACCGACCTCGGCAAGCGTTCCTTCAAT
TACATTGATGAAGAAAACGTCAATATTAACATGGAAAACAAGGTGAACTTCCACACCGTCCGCCTCGGTC
TGAACTACAAGTTCTA

Protein Sequence
>WP_002964719.1 MULTISPECIES: porin family protein [Brucella]
MFSLKGTVMKTALLASVAMLFTSSAMAADIIVAEPAPVAVDTFSWTGGYIGINAGYAGGKFKHPFSGIEQ
DGAQDFSGSLDVTASGFVGGVQAGYNWQLANGLVLGGEADFQGSTVKSKLVDNGDLSDIGVAGNLSGDES
FVLETKVQWFGTVRARLGFTPTERLMVYGTGGLAYGKVKTSLSAYDDGESFSAGNSKTKAGWTLGAGVEY
AVTNNWTLKSEYLYTDLGKRSFNYIDEENVNINMENKVNFHTVRLGLNYKF

Molecule Role Protective antigen
Related Vaccines(s) B. melitensis 16M DNA vaccine expressing Omp31
References