VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

RpsL

Gene Name RpsL
Sequence Strain (Species/Organism) Brucella melitensis bv. 1 str. 16M
VO ID VO_0010963
NCBI Gene ID 1196463
NCBI Protein GI 161511151
Locus Tag BMEI0752
Genbank Accession NZ_GG703780
Protein Accession NP_539669
Taxonomy ID 224914
Chromosome No I
Gene Starting Position 782951
Gene Ending Position 783322
Gene Strand (Orientation) +
Protein Name 30S ribosomal protein S12
Protein pI 12.15
Protein Weight 12482.71
Protein Length 123
Protein Note interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone; located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side; mutations in the S12 gene confer streptomycin resistance
DNA Sequence
>gi|17986284:782951-783322 Brucella melitensis 16M chromosome I, complete sequence
AATGCCTACCGTAAACCAGCTTATCCGCAAGCCGCGCACTGCGCCGGTGAAGCGCAATAAGGTTCCTGCA
CTGCAGGCAAACCCTCAGAAGCGCGGCGTTTGCACCCGCGTTTACACGACGACCCCGAAGAAGCCGAACT
CGGCTCTGCGTAAGGTTGCCAAGGTTCGTCTGACGAACGGCTTTGAAGTCATTGGTTATATCCCTGGTGA
AGGGCATAACCTGCAGGAGCACTCCGTCGTGATGATCCGTGGCGGTCGTGTGAAGGACTTGCCGGGTGTG
CGTTACCACATCATCCGTGGCGTTCTCGATACCCAGGGTGTCAAGAACCGCAAGCAGCGCCGTTCCAAGT
ACGGTGCAAAGCGTCCGAAGTA
Protein Sequence
>gi|161511151|ref|NP_539669.2| 30S ribosomal protein S12 [Brucella melitensis 16M]
MPTVNQLIRKPRTAPVKRNKVPALQANPQKRGVCTRVYTTTPKKPNSALRKVAKVRLTNGFEVIGYIPGE
GHNLQEHSVVMIRGGRVKDLPGVRYHIIRGVLDTQGVKNRKQRRSKYGAKRPK
Molecule Role Other
Related Vaccines(s) B. melitensis vaccine strain Rev. 1
References