VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Omp25

Gene Name Omp25
Sequence Strain (Species/Organism) Brucella melitensis bv. 1 str. 16M
VO ID VO_0010966
NCBI Gene ID 1196960
NCBI Protein GI 17987532
Locus Tag BMEI1249
Genbank Accession AE008917
Protein Accession NP_540166
Taxonomy ID 224914
Chromosome No I
Gene Starting Position 1297524
Gene Ending Position 1298165
Gene Strand (Orientation) -
Protein Name hypothetical protein
Protein pI 9.03
Protein Weight 21696.72
Protein Length 213
Protein Annotation Reference: http://www.ncbi.nlm.nih.gov/pubmed/17049676
DNA Sequence
>NC_003317.1:1297524-1298165 Brucella melitensis bv. 1 str. 16M chromosome I, complete sequence
ATTAGAACTTGTAGCCGATGCCGACGCGGAAATCCTGCGTGTCCAGCTTGTTGCGAACAGTCGTACCGGC
CAGATCATAGTTCTTGTTGCCGTACTGGGTGTAACGGTACTCAACGCGGCCGAGGATGTTGTCCGTCAGC
TTGGCTTCGAGACCGGCACCAGCCGTCCAACCCACGCGGAACTTGCTTTCGTCGTCCAAGCCGTTGTTAA
GCTTGATCTGCGAACCGGCAATACCAGCCGTGAGGTACGGCATAACCGGGTTCAGGTCGTAGCCAACGCG
GGCACGCAGCGAGCCTTCAAAGCCCTGCTTGACTTCCAGGCCGTCCTTGGACTTCTTGGCCCAGGAATAA
CCTGCATCACCTTCAACACCGTATACGATCTGGTCCTGCTGGAAGTTCCAGCCAGCAAAGGCGCCAGCCT
TCCAATCGTCAGGCTTGATGCTGCCAACGGTGCTGGTCTTGGCCTTGTTCCAGCCGTAGCCAAGGTAAAG
ACCGGTATAGCCACCAGCCCAGCTATACTGGGGAGCTACTTCAACCGGAGCCGGAACCGGAGGCTGTTCC
TGGATGGCGTCGGCAGCAAAAGCGGTCGCAGAGAACGGCAGCAACGCAGCCGAGACGATTACGAGAGACT
TAAGAGTGCGCA

Protein Sequence
>NP_540166.1 hypothetical protein BMEI1249 [Brucella melitensis bv. 1 str. 16M]
MRTLKSLVIVSAALLPFSATAFAADAIQEQPPVPAPVEVAPQYSWAGGYTGLYLGYGWNKAKTSTVGSIK
PDDWKAGAFAGWNFQQDQIVYGVEGDAGYSWAKKSKDGLEVKQGFEGSLRARVGYDLNPVMPYLTAGIAG
SQIKLNNGLDDESKFRVGWTAGAGLEAKLTDNILGRVEYRYTQYGNKNYDLAGTTVRNKLDTQDFRVGIG
YKF

Molecule Role Protective antigen
Molecule Role Annotation Brucella Omp25 is a protective antigen (Commander et al., 2007).
Additional Molecule Role Virmugen
Additional Molecule Role Annotation A omp25 mutant is attenuated and provides protection against challenge in mice (Edmonds et al., 2002).
Related Vaccines(s) B. melitensis DNA vaccine p-Omp25 , Brucella melitensis omp25 mutant vaccine
References