VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

IalB

Gene Name IalB
Sequence Strain (Species/Organism) Brucella melitensis bv. 1 str. 16M
VO ID VO_0010967
NCBI Gene ID 1197295
NCBI Protein GI 17987867
Locus Tag BMEI1584
Genbank Accession AE008917
Protein Accession NP_540501
Taxonomy ID 224914
Chromosome No I
Gene Starting Position 1632893
Gene Ending Position 1633414
Gene Strand (Orientation) +
Protein Name invasion protein B
Protein pI 8.98
Protein Weight 17016.04
Protein Length 173
DNA Sequence
>NC_003317.1:1632893-1633414 Brucella melitensis bv. 1 str. 16M chromosome I, complete sequence
TATGAAAAATTATCGTGCAATCGGTCTTGCATTCACGTTCACTGCCCTTTCCAGTCTTTCGGCCTTTGCA
GCCTCCCTGCCCGGCGGAGCAAGCACCTTGCAGGAAACCTATCAGGACTGGACCGTGTCTTGCCAGTCGC
AGAAGGATACAACAGCCTGCGTGATGCGTCAGGAGCAAAGCAGCGCCCAGGCCGGCCAGCGCGTTCTGAC
TGCCGAGCTGCGCAACGTCGCCGGCGGCAAAGTTGACGGTGTGTTGCTGATGCCGTTCGGTCTTGATCTT
GCCAAGGGCGCCTCGCTCAAGATTGATGACACCGCTGGGCCAAACCTCACCTTCTCCACCTGCCTGCCGC
AGGGCTGCCTCGCGCCAGTGAGCTTCGATGCCAAGCAGGTTGCTGCGCTGAAATCCGGCACCAACATCAA
TGTCACCACGACGGCGCTCAGCCCGAGCCAGCCGGTTGCCTTCAAGATTTCCCTGAAAGGCTTCGGTGCC
GCGCTCGACCGCATTCAGGCATTGACCAAGTA

Protein Sequence
>NP_540501.1 invasion protein B [Brucella melitensis bv. 1 str. 16M]
MKNYRAIGLAFTFTALSSLSAFAASLPGGASTLQETYQDWTVSCQSQKDTTACVMRQEQSSAQAGQRVLT
AELRNVAGGKVDGVLLMPFGLDLAKGASLKIDDTAGPNLTFSTCLPQGCLAPVSFDAKQVAALKSGTNIN
VTTTALSPSQPVAFKISLKGFGAALDRIQALTK

Molecule Role Protective antigen
Molecule Role Annotation Brucella IalB is a protective antigen (Commander et al., 2007).
Related Vaccines(s) B. melitensis DNA vaccine p-ialB
References