VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Tig

Gene Name Tig
Sequence Strain (Species/Organism) Brucella melitensis bv. 1 str. 16M
VO ID VO_0010969
NCBI Gene ID 1196780
NCBI Protein GI 17987352
Locus Tag BMEI1069
Genbank Accession AE008917
Protein Accession NP_539986
Taxonomy ID 224914
Chromosome No I
Gene Starting Position 1112655
Gene Ending Position 1114112
Gene Strand (Orientation) -
Protein Name trigger factor
Protein pI 4.64
Protein Weight 50680.09
Protein Length 485
Protein Note Tig; RopA; peptidyl-prolyl cis/trans isomerase; promotes folding of newly synthesized proteins; binds ribosomal 50S subunit; forms a homodimer
Protein Annotation Also called Tf: Trigger Factor.
DNA Sequence
>NC_003317.1:1112655-1114112 Brucella melitensis bv. 1 str. 16M chromosome I, complete sequence
ATCAAGCCTCTTCGGACTTGCCTTCTTCGGCCTTCTTCTTCGGCGCAGCCTTCTTCTTCGCAGCCGCCTT
CTTGGCAGGCTTTGCTTCCGAAGCTGCATCTTCGTCTTCAGCCGTCAGCTCTTCCTTCGAGACCTTCTTG
TCGGTCACATTGATGTTGGCCAGCAGATGATCGACGACCTTTTCTTCAAAGATCGGCGCGCGCAGATTGG
CGACGGCATCCGGCGTACGGCGCAGGAAGTCGTAGATTTCCTTTTCCTGACCCGGATAGCGGCGAACCTG
ATCGTAAACAGCGCGCTGCAGTTCTTCTTCGGTCACTTCCACGCCTGCCTTCTCGCCGATTTCGGAGAGA
ACGAGGCCAAGACGAACGCGGCGTTCTGCAAGCTTGCGATATTCTTCGCGAGCAGCTTCTTCCGTCGTTT
CCTCGTCTTCAAAGGTGCGGCCAGCCTGCTGCAGGTCGAAGTTGATCTGCTGCCAGATGTTGTTGAACTC
GGCGTCAACCAGCTTCTGCGGGGTTTCAAACTGATAATCACCATCAAGGGCGTCGAGAATCTGACGCTTC
ACTTTCTGGCGGGTGATCTGGCCGTACTGGCTTTCGATCTGTTCGCGCACAACCTGACGCAGACGCTCAA
GCGACTCAATGCCGAGCTTCTTTGCGGTTTCGTCATCGAGAACGAGTTCGTTCGGCTTGGCAACTTCCTT
CACCTTGATGTCGAAGGTTGCTTCCTTGCCAGCCAGATGCGCAGCGCCGTATTCAGCCGGGAACGTTACG
GTGATGACCTTCTCGTCGCCAGCCTTCAAGCCAATGAGCTGTTCTTCAAAGCCCGGAATGAACTGGCCGG
AACCGAGAACGAGCTGTGCGTCATTGTCTGCACCGCCTTCAAACGGCTCGCCGTCGAGCTTGCCCAGATA
GTCGATCGTGACGCGATCTTCGTTTTCGGCCTTGCCCTTCTTGGTTTCAAAGGTGCGGGTCGACGACGCA
ATGCGCTTGACCTGTTCATCGACTTCCTCATCGGAAATGTCGACGACTTCACGGGTCACGGCGATCTTGG
AGAAGTCCTTGACCTCGATTGCCGGCAGCACTTCATAGTTCAGCGAGAAAACGAAATCGGCCTTGCCGTC
GAGAACCTTCTCGGCTTCTTTTTCGTCTTCCGACATGATGACTTCAGGCTGGGTCGCCGACTTTTCGTTG
CGTTCGGCAAGGATGGAACGCGACGAATCGTTGAGGATTTCGTTGACGATCTCGGCCATGAAGGACTTGC
CGTACATCTTGCGCAGGTGAGCCGTCGGCACCTTGCCCGGACGGAAGCCGTTGATGCGGGCGCGGCCGCG
CGCGGTTTCGAGCCGCTCAGCGAGCTTGGCTTCAAGATCCCCGGCCGGAACCACGACTTTGATCTCGCGC
TTCAGCCCTTCATTGAGCGTTTCGGTAACCTGCATGTTCAAACCTTCACTTCTTGTCA

Protein Sequence
>NP_539986.1 trigger factor [Brucella melitensis bv. 1 str. 16M]
MTRSEGLNMQVTETLNEGLKREIKVVVPAGDLEAKLAERLETARGRARINGFRPGKVPTAHLRKMYGKSF
MAEIVNEILNDSSRSILAERNEKSATQPEVIMSEDEKEAEKVLDGKADFVFSLNYEVLPAIEVKDFSKIA
VTREVVDISDEEVDEQVKRIASSTRTFETKKGKAENEDRVTIDYLGKLDGEPFEGGADNDAQLVLGSGQF
IPGFEEQLIGLKAGDEKVITVTFPAEYGAAHLAGKEATFDIKVKEVAKPNELVLDDETAKKLGIESLERL
RQVVREQIESQYGQITRQKVKRQILDALDGDYQFETPQKLVDAEFNNIWQQINFDLQQAGRTFEDEETTE
EAAREEYRKLAERRVRLGLVLSEIGEKAGVEVTEEELQRAVYDQVRRYPGQEKEIYDFLRRTPDAVANLR
APIFEEKVVDHLLANINVTDKKVSKEELTAEDEDAASEAKPAKKAAAKKKAAPKKKAEEGKSEEA

Molecule Role Protective antigen
Molecule Role Annotation protective antigen (Yang et al., 2007)
Related Vaccines(s) B. melitensis bp26 and TF Nasal Vaccine
References