VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

SurA

Gene Name SurA
Sequence Strain (Species/Organism) Brucella abortus 2308
VO ID VO_0010971
NCBI Gene ID 3787419
NCBI Protein GI 489056605
Locus Tag BAB_RS19295
Genbank Accession JMRZ01000012
Protein Accession WP_002966738
Taxonomy ID 359391
Chromosome No I
Gene Starting Position 688353
Gene Ending Position 689309
Gene Strand (Orientation) -
Protein Name molecular chaperone SurA
Protein pI 10.47
Protein Weight 32511.89
Protein Length 318
DNA Sequence
>NC_007618.1:688353-689309 Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308
GTCAACGATTGACGATGGTGGCCTTTTCGCGCAGTTCCTGCACGTATTTCTTGCTGAGTTCCTCAGCCTT
CTTTTCCTGCCCCGCAGGGGAATCCGCGCCTTCCATGGAGAAGACAAGCTGTGCAACGCGGTCATCCGAC
ACCTGACGGGTGGAGCATACGGCCAGGAATTCAACACCCTTTTCCGTATCGTGCGGCTTGGTCGTCCGGT
TGACGCCAGCGGCCTTCACATCCTTGGACCATTCGCCGGGCAATTGCGGCTCGATGATACGGCCAAGATC
GCGGACGGTCACATCGAGAATGCCCTTGGCTTGCTGGCGCGTGCTGTCACAATTCTGGAAGCGCGCGCGC
AACGCATTGGCTTCCTGACGGCGTTTTGCCAGAAGAGCGGGCGAACGCTTGGAGGCGGGGACCACGAAAA
TCACCTGCTGGAGATGATATTCAGTTGCAACGGGCTTCTTTCCGCCGTTCTTCAGCATACGCTGCACGGC
TTCCTGCTCACTGACCATGCCGGTCGCGCGGAAGCGGGCGCTGACAAGGCGGCCCCAGCCCATCTGGACC
ATGATATATTTCTTGAAATGTTCCGGCGTGACGCCCGACTGGTTCATAACCTGATTGAGCTGCGCCAGCG
TCATCTTGTTGCGGCTTGCAAACCCGGCATAGGCGTCATCCACTTCCTTATCGGAAATATTGATGCCACG
CGATTTCATCTCGATGCGCTTGAGCATTTCTTCGGTAAGCTCGTTGCGCGCAAGCTGGTTGAGATTGCCG
CTTTTACGCTGAAGCTTGAGGAAGGCCATACGGTGCTTGATGTCGCTATTGGTAATAGCATTGCCGGACA
CGATGACTTTGACCTCGGATTCTCCTGCGGCGAAAGCTGGAGCCGCAACCGTTCCAAGCGCCGTCAAGCA
AACGGCAGCGCCTAGCATGGAGGCGATAAGAGGTCTTGCAAACATCA

Protein Sequence
>WP_002966738.1 MULTISPECIES: peptidylprolyl isomerase [Brucella]
MMFARPLIASMLGAAVCLTALGTVAAPAFAAGESEVKVIVSGNAITNSDIKHRMAFLKLQRKSGNLNQLA
RNELTEEMLKRIEMKSRGINISDKEVDDAYAGFASRNKMTLAQLNQVMNQSGVTPEHFKKYIMVQMGWGR
LVSARFRATGMVSEQEAVQRMLKNGGKKPVATEYHLQQVIFVVPASKRSPALLAKRRQEANALRARFQNC
DSTRQQAKGILDVTVRDLGRIIEPQLPGEWSKDVKAAGVNRTTKPHDTEKGVEFLAVCSTRQVSDDRVAQ
LVFSMEGADSPAGQEKKAEELSKKYVQELREKATIVNR

Molecule Role Protective antigen
Molecule Role Annotation Brucella SurA is a protective antigen (Delpino et al., 2007b).
Related Vaccines(s) Brucella recombinant SurA protein vaccine
References