VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

Omp16

Gene Name Omp16
Sequence Strain (Species/Organism) Brucella abortus 2308
VO ID VO_0010973
NCBI Gene ID 3788229
NCBI Protein GI 489056820
Locus Tag BAB_RS24085
Genbank Accession AM040264
Protein Accession WP_002966947
Taxonomy ID 359391
Chromosome No I
Gene Starting Position 1654432
Gene Ending Position 1654938
Gene Strand (Orientation) -
Protein Name hypothetical protein
Protein pI 10.24
Protein Weight 17438.15
Protein Length 168
Protein Annotation Synonyms: Omp16, MotY
DNA Sequence
>NC_007618.1:1654432-1654938 Brucella melitensis biovar Abortus 2308 chromosome I, complete sequence, strain 2308
TTTACCGTCCGGCCCCGTTGAGAACGGTGACGGCGCGACGGTTCTGCGACCAGCATGTGTCGGCATCGCA
GACGGCAACCGGGCGCTCATTACCGTAGGAAATGGTGCGCATGCGGTTGGTCGGCACACCGCGCGAAGCG
AGGAAGTCGCGGGTGGCGGCAGCACGGCGCTGGCCAAGGGCGAGGTTGTACTCACGCGTGCCGCGCTCGT
CGGCATGGCCTTCGATCGTGATCGAATACTGCGGATAACGCTGCAACCACTGGGCCTGCTTGGAAAGCGT
CTGCTGCGCATCGGCGCGGATCAGCGACGAATCGAGATCGAAGAAGATGCGGTCGCCGACATTAACGGTG
AAGTCCTGCGAGGAGCCCGGCGTTGCAGCGCCTGCACCGAGACCCAGATCACCGGCATTATTCGGAAGGT
TCTTCTTTGACGCACAGCCGGCAACGGCGAGCGACATGAAAAGCGCAATAGCGATCGGGCTACGTGCAAT
CGACTGGATACGGCGCA

Protein Sequence
>WP_002966947.1 MULTISPECIES: hypothetical protein [Brucella]
MRRIQSIARSPIAIALFMSLAVAGCASKKNLPNNAGDLGLGAGAATPGSSQDFTVNVGDRIFFDLDSSLI
RADAQQTLSKQAQWLQRYPQYSITIEGHADERGTREYNLALGQRRAAATRDFLASRGVPTNRMRTISYGN
ERPVAVCDADTCWSQNRRAVTVLNGAGR

Molecule Role Protective antigen
Molecule Role Annotation Brucella Omp16 is a protective antigen (Pasquevich et al., 2009).
Related Vaccines(s) B. abortus DNA vaccine encoding RplL and Omp16
References