VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

GNA1946

Gene Name GNA1946
Sequence Strain (Species/Organism) Neisseria meningitidis MC58
VO ID VO_0010974
NCBI Gene ID 904205
NCBI Protein GI 15677776
Locus Tag NMB1946
Genbank Accession AE002098
Protein Accession NP_274940
3D structure: PDB ID 3GXA
Taxonomy ID 122586
Gene Starting Position 2041081
Gene Ending Position 2041944
Gene Strand (Orientation) -
Protein Name outer membrane lipoprotein
Protein pI 4.96
Protein Weight 29236.71
Protein Length 287
Protein Note identified by similarity to EGAD:30554; match to protein family HMM PF03180
DNA Sequence
>NC_003112.2:2041081-2041944 Neisseria meningitidis MC58 chromosome, complete genome
CTTATTTGGCTGCGCCTTCATTCCATGCGGCAGGGGATTTGTAGCCCTCGAAGCGTTTGTGCGCGTAGGC
TTTGAACGCGTCGGAGTTATAGGCCTCGGTTACGTCTTTAAGCCATTGGCTGTCTTTGTCGGCGGTTTTG
ACGGCAGACCAGTTGACATAGGCAAAGCTCGGTTCTTGGAACAGGGCTTCGGTCAGCTTCATGCCGCTGC
TTATGGCGTAGTTGCCGTTGACGACGGCAAAATCCACGTCGGCGCGGCTACGCGGCAGTTGCGCGGCTTC
AAGCTCGACGATTTTGATGTTTTTCAGGTTCTCGGCGATGTCCGCTTTGGATGCGGTCAACGGATTGATG
CCGTCTTTGAGTTTGATCCAACCCAGTTCGTCGAGCATCACCAAGACGCGGGCGAAGTTGGACGGGTCGT
TGGGCGCGGATACGGTGCTGCCGTCTTTGACTTCTTCCAGCGATTTCAGCTTGCCCGGGTACAGTCCCAA
AGGCGCGGTCGGCACTTGGAAGACTTCGGTGATGTCCAGATTGTGTTCTTTTTTGAAGTCGTCAAGATAG
GGTTTGTGTTGGAAGACGTTGATGTCCAACTCGCCCTCAGCCAATGCCAGATTCGGGCGTACATAGTCGG
TAAACTCGACCAGTTTGACGGTGTAGCCTTTTTTCTCCAGCTCGGCTTGGATTTGTTCTTTGACCATATC
GCCGAAGTCGCCGACGGTCGTGCCGAAGACGATTTCTTTTTTCGCCGCGCCGTTGTCGGCGGCGGCAGAA
GCGGATGCGGCGGGCGCGCTGTCTTTTTGACCGCCGCAGGCGGCGAGGATGAGCGCGAGTGCGGCGGCGG
AAAGGGTTTTGAAGAAGGTTTTCA

Protein Sequence
>NP_274940.1 outer membrane lipoprotein [Neisseria meningitidis MC58]
MKTFFKTLSAAALALILAACGGQKDSAPAASASAAADNGAAKKEIVFGTTVGDFGDMVKEQIQAELEKKG
YTVKLVEFTDYVRPNLALAEGELDINVFQHKPYLDDFKKEHNLDITEVFQVPTAPLGLYPGKLKSLEEVK
DGSTVSAPNDPSNFARVLVMLDELGWIKLKDGINPLTASKADIAENLKNIKIVELEAAQLPRSRADVDFA
VVNGNYAISSGMKLTEALFQEPSFAYVNWSAVKTADKDSQWLKDVTEAYNSDAFKAYAHKRFEGYKSPAA
WNEGAAK

Molecule Role Protective antigen
Molecule Role Annotation Protective antigen (Pizza et al., 2000)
References