VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

GNA1220

Gene Name GNA1220
Sequence Strain (Species/Organism) Neisseria meningitidis MC58
VO ID VO_0010975
NCBI Gene ID 903642
NCBI Protein GI 15677093
Locus Tag NMB1220
Genbank Accession AE002098
Protein Accession NP_274245
Taxonomy ID 122586
Gene Starting Position 1224371
Gene Ending Position 1225318
Gene Strand (Orientation) -
Protein Name hypothetical protein
Protein pI 5.52
Protein Weight 32124.16
Protein Length 315
Protein Note identified by similarity to GP:2984585; match to protein family HMM PF01145
DNA Sequence
>NC_003112.2:1224371-1225318 Neisseria meningitidis MC58 chromosome, complete genome
CTTATTTGGCGGTTTTGCTGCTGTCGATAATTTTCATACCGGCAGAAATCAGGCTGCCGATGTCGGCAAC
ATTGGCGGGCATAATCAGCGTATTGCTTTCTTTGGCAAGATTGTTGAACGCAGCGACGTATTGTTCCGCA
ATCTTCAGATTGACCGCATCCGCACCGCCTTGGGTTTGAAGGGCGGCGGCAATTTGACGGATGGCTTCGG
CATTGGCTTCGGCAACAAGGCGCAAGGATTCCGCTTCACCTTTGGCGCGGTTGATGCGGGCGATTTTCTC
GGCATTTGACGCATTGACCGCAGCCTGAGCCTCGCCTTCGGATTGTTGGATTTCGGCTTCGCGCTGACCA
CTGGCAAGGTTGATTTGTTCGATTTTACGACCTTCGGATTCGGCGATACGGGCGCGTTTTTCGCGTTCGG
CAGTAATTTGCGCCTGCATTGAGCGAAGGATTTCTTGCGGCGGAACCAAGTCTTTAATCTCATAACGCAA
AACCTTCACACCCCAAGCCCCGGCCGCCTCGTCCAAAGCCGCAACAACAGTACTGTTGATTTCGTCGCGT
TCTTCAAACGTTTTGTCCAACTCCATACGCCCGATAACGGAACGCAGCGTCGTTTGGGCAAGCTGGGTAA
TCGCCATAATGTAGTTGCTCGAACCGTATGAGGCGAGTTTGGGGTCGGTTACTTGGAAATAGATGATGCC
GTCAACAGTCAGCTGCGTATTGTCGCGCGTGATGCAGACCTGGCTGGGTACGTCTAAAGGGATTTCTTTC
AGCGAATGGCGGTAGGCGACGCGGTCGATAAAGGGAATCAAAATATTCAAACCGGCCGTCAGGGCGCGAT
GGAAACGCCCCAGCCTTTCGACAACGTGGACTTCCTGTTGTGGGATGACAACAAAGGATTTGAAACCGAA
AACGGCGACGGCTACCAACAAGATAATGAAAAATTCCA

Protein Sequence
>NP_274245.1 hypothetical protein NMB1220 [Neisseria meningitidis MC58]
MEFFIILLVAVAVFGFKSFVVIPQQEVHVVERLGRFHRALTAGLNILIPFIDRVAYRHSLKEIPLDVPSQ
VCITRDNTQLTVDGIIYFQVTDPKLASYGSSNYIMAITQLAQTTLRSVIGRMELDKTFEERDEINSTVVA
ALDEAAGAWGVKVLRYEIKDLVPPQEILRSMQAQITAEREKRARIAESEGRKIEQINLASGQREAEIQQS
EGEAQAAVNASNAEKIARINRAKGEAESLRLVAEANAEAIRQIAAALQTQGGADAVNLKIAEQYVAAFNN
LAKESNTLIMPANVADIGSLISAGMKIIDSSKTAK

Molecule Role Protective antigen
Molecule Role Annotation Protective antigen (Pizza et al., 2000)
References