VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

GNA1162

Gene Name GNA1162
Sequence Strain (Species/Organism) Neisseria meningitidis MC58
VO ID VO_0010976
NCBI Gene ID 903582
NCBI Protein GI 15677037
Locus Tag NMB1162
Genbank Accession AE002098
Protein Accession NP_274189
Taxonomy ID 122586
Gene Starting Position 1167697
Gene Ending Position 1168344
Gene Strand (Orientation) -
Protein Name hypothetical protein
Protein pI 6.26
Protein Weight 20946.7
Protein Length 215
DNA Sequence
>NC_003112.2:1167697-1168344 Neisseria meningitidis MC58 chromosome, complete genome
CTTATTTGGGCTGCTCTTCAACGAATCTCGGACCTTTCAAGATGCCGTTGTGAGAATAGGGCGACAGCAG
GTTGTATGCGGCGGTTTTGGAAACCTGATAACCGCGGTCGGTCAGGCTGTTGGCAATCTGATTGACCACT
GCGCTGACCAAAGCCCCCAACAGGCCGCTGTTGCTGTTGTTGCTGCCTTCGCGGATGCTGGCCGAACCCG
ACCACAACTCTTTTCCGTTGCGGGAATCGACCAGCCGTGCTTTGGCGGATACGGTCGTCACGCTGTCTAA
AATTTGATATGAAGTGCCGTATTCGGTAACCGTAATGTACAAAACCGCATCATTGCCGAAAATCTGATGC
AGTTTTTCCGGCCGGACGGCGTGAATATCGGCGGCATTGGTCAAGCCGTTTTGTTTGAAGGTTTCCTCCA
CGACTGCGGCGGGGAAGACGTAATAGCCGGCTTCGGAAAGCGGCGCGGCGGTCGAAGCCAGTACACCCCA
TGTTCCGTTGACATCGGGCGATTCGTTCAGCGGCGGAACCACCAAAATTGAAGCCGGTTTGCTTTCCTTG
AATGACGTGTAGTCGAAATCGGGCGCTTTTTGAACTTGGCAGGCAGACAGCGCCAACACGGCGGCAAGCC
CTAAAATCAAAGGTTTCA

Protein Sequence
>NP_274189.1 hypothetical protein NMB1162 [Neisseria meningitidis MC58]
MKPLILGLAAVLALSACQVQKAPDFDYTSFKESKPASILVVPPLNESPDVNGTWGVLASTAAPLSEAGYY
VFPAAVVEETFKQNGLTNAADIHAVRPEKLHQIFGNDAVLYITVTEYGTSYQILDSVTTVSAKARLVDSR
NGKELWSGSASIREGSNNSNSGLLGALVSAVVNQIANSLTDRGYQVSKTAAYNLLSPYSHNGILKGPRFV
EEQPK

Molecule Role Protective antigen
Molecule Role Annotation Protective antigen(Pizza et al., 2000)
References