VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

GNA992 (hsf)

Gene Name GNA992 (hsf)
Sequence Strain (Species/Organism) Neisseria meningitidis MC58
VO ID VO_0010977
NCBI Gene ID 903112
NCBI Protein GI 15676883
Locus Tag NMB0992
Genbank Accession AE002098
Protein Accession NP_274028
Taxonomy ID 122586
Gene Starting Position 1005588
Gene Ending Position 1007363
Gene Strand (Orientation) -
Protein Name adhesin
Protein pI 5.98
Protein Weight 56655.27
Protein Length 591
Protein Note identified by similarity to EGAD:131908; match to protein family HMM PF03895; match to protein family HMM PF05662
Protein Annotation hsf or called GNA992
DNA Sequence
>NC_003112.2:1005588-1007363 Neisseria meningitidis MC58 chromosome, complete genome
CTTACCACTGATAACCGACAGATGCGGAAGCACCGAAATGGCCGCGCGAATTGCCGGAAGCCGTGCCTTT
GATAATCCAATTTCCGCCGTCGGAAATACTGGAGTAGCCGATGGCGTAACCGGCTTCGCCGCGATAAGTG
CCGCCGCCGATCGCCATCATACTCTTGCCGGGCAAATACGCCTGAACCAGACCTGCGGTTGCAATCGCTT
GGGCGATGCCCGCACGCGCGTTGCCGTCCACATTGTCGATGCGGTTGTTCAAGTTTTGCGCCACGCCTTT
AAGTTGTGCGACGTTTGTAACATCCCCCTCTTTAACGCCCGGGGCGACATTGGTAATGCGGACGGGTTTG
TTGTCCTTCTTGCTGCCGACATTCAATGCGTCCCCATCCACGCTCAAAGTGGGCGCATCCGCCCCCGCGC
CGAGCGAAACGCTGGAAAACTGCGGGGTCATCGAAGTGGCGATGTCGATATTTTTACCGTTGCGGGTAAT
CTCGATGTTGTTGCCGGCATTAATGTTGACGGTTTCATCCATCTTTCCCTTGCTCGGCGAAACATTGCCG
CTGATGACTTTGCCCGAAGAACCTGCAACCGCTTTGGAATCCAAATTCCAACCGCTGTTTTGCAGCTGAT
TGACGTTTAGGGCATCGCCGACATTTACATCATACATAACAGTGATGTTGCCTTGATCATCTTTACTTAC
AGTCGCAGTTGTACCTTTACCACTAGCAAAGGTTACATTTGTGCCTGATGTAACGGTTTCAAACTTGTCA
GCTTGACCTGTTTGACCATTAGCGGTTGTTGTTTTCATTCTCCAACCAGCCTTGTTTACTGCATCAATCA
CTTCTTTTGCAGTCACTAAGCCTTCGCCTTCGTCTGTAGAAGAACCATTCTCGCCTTTGTCTTTACCAGT
AACCAACTTACCGTCTTTTTCTTTAATAACAGAAGTCTTCGCACCGATTTTAACTTCGGTTTTCTTGCCG
TTGTCTTTGCTTTCCACATTAACAGTCGTTGTTTTCGTATCTGCGCTCAAGAACTCGACTGTGTCGTAAG
TGCGGACGAAATCAACGTTATCGGAAGCTGTTGTACCGGGTTTAACGCCTTTAATGTTCCAGCCAGCGTT
TAATACGTCTTTAACGCTTGCCGCACGTTTTTTCTCGTCATCGGTAACGTTGTCGTTGGTTACGTTTGTG
GTCGCTCCGGTATTCAGCAGCGTATCGGTCAAAGTCGAACCAATACCGTTCAGATGAACCGTGGTGTCGC
CGTTCGTCCCAGCCGTTTCTTTCGCAAAATTCAAGCCTTTGGTGTCGCTTGTGATGTTGACTTTATTGCC
GTTTGCGCTAAACGATAATTTTTCAGTTCCAACACTGGTCAGATCTGTGAGGTCTTTTTTCAGCGAGTAG
GTGAAGTTTGTGCCGTTTTGTTTGATTTTCAGGTTGTCGCCGGCTTTGAGGGTGATTTCTCTGGCTGTTA
GTACTCCTTTCTCGTTGAAATATACTGCCCAATCTGAATTTTCTTCTACTTTTTCTTTTTCTCCCGTGCC
TTCTTTATCGGAATTGACTATCAACACGGCAACAGTGCGTTGTACGGGGTCTAAATATAAATCTTCTTCT
TGCTCTTCATTGTTAGCACTTGCCTGAACCGTTGCAAACAACAGTGTCGCCAATACGGCGGTCTTCACGG
TTGCGGAGGCGCGTTTGGTGTGGTTGCGTGTGAGCTCGGATACGACGACCCAGGCATTGAGGGCACTATT
CCAAATGATGCGGTATATTTTGTTCA

Protein Sequence
>NP_274028.1 adhesin [Neisseria meningitidis MC58]
MNKIYRIIWNSALNAWVVVSELTRNHTKRASATVKTAVLATLLFATVQASANNEEQEEDLYLDPVQRTVA
VLIVNSDKEGTGEKEKVEENSDWAVYFNEKGVLTAREITLKAGDNLKIKQNGTNFTYSLKKDLTDLTSVG
TEKLSFSANGNKVNITSDTKGLNFAKETAGTNGDTTVHLNGIGSTLTDTLLNTGATTNVTNDNVTDDEKK
RAASVKDVLNAGWNIKGVKPGTTASDNVDFVRTYDTVEFLSADTKTTTVNVESKDNGKKTEVKIGAKTSV
IKEKDGKLVTGKDKGENGSSTDEGEGLVTAKEVIDAVNKAGWRMKTTTANGQTGQADKFETVTSGTNVTF
ASGKGTTATVSKDDQGNITVMYDVNVGDALNVNQLQNSGWNLDSKAVAGSSGKVISGNVSPSKGKMDETV
NINAGNNIEITRNGKNIDIATSMTPQFSSVSLGAGADAPTLSVDGDALNVGSKKDNKPVRITNVAPGVKE
GDVTNVAQLKGVAQNLNNRIDNVDGNARAGIAQAIATAGLVQAYLPGKSMMAIGGGTYRGEAGYAIGYSS
ISDGGNWIIKGTASGNSRGHFGASASVGYQW

Molecule Role Protective antigen
Molecule Role Annotation Protective antigen (Pizza et al., 2000)
References