VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

NspA from N. meningitidis MC58

Gene Name NspA from N. meningitidis MC58
Sequence Strain (Species/Organism) Neisseria meningitidis MC58
VO ID VO_0010979
NCBI Gene ID 902774
NCBI Protein GI 15676561
Locus Tag NMB0663
Genbank Accession AE002098
Protein Accession NP_273705
3D structure: PDB ID 1P4T
Taxonomy ID 122586
Gene Starting Position 690297
Gene Ending Position 690821
Gene Strand (Orientation) -
Protein Name outer membrane protein
Protein pI 10.02
Protein Weight 17106.9
Protein Length 174
Protein Note identified by similarity to EGAD:137514; match to protein family HMM PF02462
DNA Sequence
>NC_003112.2:690297-690821 Neisseria meningitidis MC58 chromosome, complete genome
ATCAGAATTTGACGCGCACACCGGCGGACAGTTCGCCGGAACGGACGTTTTTGACAGTGTTGACTTTGCC
GATGTAGTTGTAGCGGTAGCCGGCATCCAAATCGACATTCGGGGTAACGGCATAGCTTACGCCCGTCAAT
ACGCCGAGGCCGATGGAGGTTTGGCTGAAGCTGTCGCTGCCGCCCAAGTCGACGGAGGCGCGGTTGAGGC
TCAAGCGCGCGCCGAGATACGGTTTGACGGGCGATTGGGTGTCGAAGTCGTAAATGGCGGACGCGCCGAT
GCTGTAAAGTTTGAAATCGGTGGATGGGGCTTTATAGTTTTTGTAGCGCGTGTAATCGACGGCGAAGCGG
AGGTCGTTGATGCGGTAGCCTGCGGAGATGCGCGGGCTGAAGCCTTTGGCAGAACCTAAAGAGCTTGAGG
CTTTTGCGTGTGCGGCATCGGCTTGGACGTAAAAGCCGGATGCGCCTTCCGCCAGTGCGGCGGCCGGGAG
AGCGAGGGCAATCAGTGTGGCAAGTGCTTTTTTCA

Protein Sequence
>NP_273705.1 outer membrane protein [Neisseria meningitidis MC58]
MKKALATLIALALPAAALAEGASGFYVQADAAHAKASSSLGSAKGFSPRISAGYRINDLRFAVDYTRYKN
YKAPSTDFKLYSIGASAIYDFDTQSPVKPYLGARLSLNRASVDLGGSDSFSQTSIGLGVLTGVSYAVTPN
VDLDAGYRYNYIGKVNTVKNVRSGELSAGVRVKF

Molecule Role Protective antigen
Molecule Role Annotation Protective antigen (Martin et al., 1997)
NspA-containing outer membrane vesicles conferred protection against otherwise lethal intraperitoneal challenge of mice with N. meningitidis serogroup B, and sera raised against them mediated opsonophagocytosis of meningococcal strains expressing this antigen (O'dwyer et al., 2004).
Related Vaccines(s) N. meningitidis NspA Protein Vaccine
References