VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

NadA

Gene Name NadA
Sequence Strain (Species/Organism) Neisseria meningitidis MC58
VO ID VO_0010980
NCBI Gene ID 904134
NCBI Protein GI 15677822
Locus Tag NMB1994
Genbank Accession AE002098
Protein Accession NP_274986
Taxonomy ID 122586
Gene Starting Position 2100382
Gene Ending Position 2101476
Gene Strand (Orientation) +
Protein Name adhesin/invasin
Protein pI 4.54
Protein Weight 35292.78
Protein Length 364
Protein Note identified by similarity to GP:2735093; match to protein family HMM PF03895
DNA Sequence
>NC_003112.2:2100382-2101476 Neisseria meningitidis MC58 chromosome, complete genome
AATGAGCATGAAACACTTTCCATCCAAAGTACTGACCACAGCCATCCTTGCCACTTTCTGTAGCGGCGCA
CTGGCAGCCACAAGCGACGACGATGTTAAAAAAGCTGCCACTGTGGCCATTGTTGCTGCCTACAACAATG
GCCAAGAAATCAACGGTTTCAAAGCTGGAGAGACCATCTACGACATTGGTGAAGACGGCACAATTACCCA
AAAAGACGCAACTGCAGCCGATGTTGAAGCCGACGACTTTAAAGGTCTGGGTCTGAAAAAAGTCGTGACT
AACCTGACCAAAACCGTCAATGAAAACAAACAAAACGTCGATGCCAAAGTAAAAGCTGCAGAATCTGAAA
TAGAAAAGTTAACAACCAAGTTAGCAGACACTGATGCCGCTTTAGCAGATACTGATGCCGCTCTGGATGA
AACCACCAACGCCTTGAATAAATTGGGAGAAAATATAACGACATTTGCTGAAGAGACTAAGACAAATATC
GTAAAAATTGATGAAAAATTAGAAGCCGTGGCTGATACCGTCGACAAGCATGCCGAAGCATTCAACGATA
TCGCCGATTCATTGGATGAAACCAACACTAAGGCAGACGAAGCCGTCAAAACCGCCAATGAAGCCAAACA
GACGGCCGAAGAAACCAAACAAAACGTCGATGCCAAAGTAAAAGCTGCAGAAACTGCAGCAGGCAAAGCC
GAAGCTGCCGCTGGCACAGCTAATACTGCAGCCGACAAGGCCGAAGCTGTCGCTGCAAAAGTTACCGACA
TCAAAGCTGATATCGCTACGAACAAAGCTGATATTGCTAAAAACTCAGCACGCATCGACAGCTTGGACAA
AAACGTAGCTAATCTGCGCAAAGAAACCCGCCAAGGCCTTGCAGAACAAGCCGCGCTCTCCGGCCTGTTC
CAACCTTACAACGTGGGTCGGTTCAATGTAACGGCTGCAGTCGGCGGCTACAAATCCGAATCGGCAGTCG
CCATCGGTACCGGCTTCCGCTTTACCGAAAACTTTGCCGCCAAAGCAGGCGTGGCAGTCGGCACTTCGTC
CGGTTCTTCCGCAGCCTACCATGTCGGCGTCAATTACGAGTGGTA

Protein Sequence
>NP_274986.1 adhesin/invasin [Neisseria meningitidis MC58]
MSMKHFPSKVLTTAILATFCSGALAATSDDDVKKAATVAIVAAYNNGQEINGFKAGETIYDIGEDGTITQ
KDATAADVEADDFKGLGLKKVVTNLTKTVNENKQNVDAKVKAAESEIEKLTTKLADTDAALADTDAALDE
TTNALNKLGENITTFAEETKTNIVKIDEKLEAVADTVDKHAEAFNDIADSLDETNTKADEAVKTANEAKQ
TAEETKQNVDAKVKAAETAAGKAEAAAGTANTAADKAEAVAAKVTDIKADIATNKADIAKNSARIDSLDK
NVANLRKETRQGLAEQAALSGLFQPYNVGRFNVTAAVGGYKSESAVAIGTGFRFTENFAAKAGVAVGTSS
GSSAAYHVGVNYEW

Molecule Role Protective antigen
Molecule Role Annotation Protective antigen (Giuliani et al., 2006; Comanducci et al., 2002). There is another nadA (quinolinate synthetase) [ Neisseria meningitidis MC58 ] with GeneID: 902509. However, according to sequence analysis, this nadA is not the same NadA that was found to be protective antigen (Giuliani et al., 2006; Comanducci et al., 2002).
References