VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

GNA1870

Gene Name GNA1870
Sequence Strain (Species/Organism) Neisseria meningitidis MC58
VO ID VO_0010981
NCBI Gene ID 904318
NCBI Protein GI 15677705
Locus Tag NMB1870
Genbank Accession AE002098
Protein Accession NP_274866
3D structure: PDB ID 1YS5
Taxonomy ID 122586
Gene Starting Position 1975217
Gene Ending Position 1976179
Gene Strand (Orientation) +
Protein Name hypothetical protein
Protein pI 9.11
Protein Weight 32796.64
Protein Length 320
Protein Note also named factor H-binding protein (fHbp) or rLP-2086 (Pizza et al., 2008).
DNA Sequence
>NC_003112.2:1975217-1976179 Neisseria meningitidis MC58 chromosome, complete genome
AATGCCGTCTGAACCGCCGTTCGGACGACATTTGATTTTTGCTTCTTTGACCTGCCTCATTGATGCGGTA
TGCAAAAAAAGATACCATAACCAAAATGTTTATATATTATCTATTCTGCGTATGACTAGGAGTAAACCTG
TGAATCGAACTGCCTTCTGCTGCCTTTCTCTGACCACTGCCCTGATTCTGACCGCCTGCAGCAGCGGAGG
GGGTGGTGTCGCCGCCGACATCGGTGCGGGGCTTGCCGATGCACTAACCGCACCGCTCGACCATAAAGAC
AAAGGTTTGCAGTCTTTGACGCTGGATCAGTCCGTCAGGAAAAACGAGAAACTGAAGCTGGCGGCACAAG
GTGCGGAAAAAACTTATGGAAACGGTGACAGCCTCAATACGGGCAAATTGAAGAACGACAAGGTCAGCCG
TTTCGACTTTATCCGCCAAATCGAAGTGGACGGGCAGCTCATTACCTTGGAGAGTGGAGAGTTCCAAGTA
TACAAACAAAGCCATTCCGCCTTAACCGCCTTTCAGACCGAGCAAATACAAGATTCGGAGCATTCCGGGA
AGATGGTTGCGAAACGCCAGTTCAGAATCGGCGACATAGCGGGCGAACATACATCTTTTGACAAGCTTCC
CGAAGGCGGCAGGGCGACATATCGCGGGACGGCGTTCGGTTCAGACGATGCCGGCGGAAAACTGACCTAC
ACCATAGATTTCGCCGCCAAGCAGGGAAACGGCAAAATCGAACATTTGAAATCGCCAGAACTCAATGTCG
ACCTGGCCGCCGCCGATATCAAGCCGGATGGAAAACGCCATGCCGTCATCAGCGGTTCCGTCCTTTACAA
CCAAGCCGAGAAAGGCAGTTACTCCCTCGGTATCTTTGGCGGAAAAGCCCAGGAAGTTGCCGGCAGCGCG
GAAGTGAAAACCGTAAACGGCATACGCCATATCGGCCTTGCCGCCAAGCAATA

Protein Sequence
>NP_274866.1 hypothetical protein NMB1870 [Neisseria meningitidis MC58]
MPSEPPFGRHLIFASLTCLIDAVCKKRYHNQNVYILSILRMTRSKPVNRTAFCCLSLTTALILTACSSGG
GGVAADIGAGLADALTAPLDHKDKGLQSLTLDQSVRKNEKLKLAAQGAEKTYGNGDSLNTGKLKNDKVSR
FDFIRQIEVDGQLITLESGEFQVYKQSHSALTAFQTEQIQDSEHSGKMVAKRQFRIGDIAGEHTSFDKLP
EGGRATYRGTAFGSDDAGGKLTYTIDFAAKQGNGKIEHLKSPELNVDLAAADIKPDGKRHAVISGSVLYN
QAEKGSYSLGIFGGKAQEVAGSAEVKTVNGIRHIGLAAKQ

Molecule Role Protective antigen
Molecule Role Annotation Protective antigen (Giuliani et al., 2006)
References