VIOLIN Logo
VO Banner
Search: for Help
About
Introduction
Statistics
VIOLIN News
Your VIOLIN
Register or Login
Submission
Tutorial
Vaccine & Components
Vaxquery
Vaxgen
VBLAST
Protegen
VirmugenDB
DNAVaxDB
CanVaxKB
Vaxjo
Vaxvec
Vevax
Huvax
Vaccine Mechanisms
Vaximmutordb
Vaxism
Vaxar
Vaccine Literature
VO-SciMiner
Litesearch
Vaxmesh
Vaxlert
Vaccine Design
Vaxign
Community Efforts
Vaccine Ontology
ICoVax 2012
ICoVax 2013
Advisory Committee
Vaccine Society
Vaxperts
VaxPub
VaxCom
VaxLaw
VaxMedia
VaxMeet
VaxFund
VaxCareer
Data Exchange
V-Utilities
VIOLINML
Help & Documents
Publications
Documents
FAQs
Links
Acknowledgements
Disclaimer
Contact Us
UMMS Logo

GNA2091

Gene Name GNA2091
Sequence Strain (Species/Organism) Neisseria meningitidis MC58
VO ID VO_0010982
NCBI Gene ID 903958
NCBI Protein GI 15677911
Locus Tag NMB2091
Genbank Accession AE002098
Protein Accession NP_275079
Taxonomy ID 122586
Gene Starting Position 2211862
Gene Ending Position 2212470
Gene Strand (Orientation) +
Protein Name hemolysin
Protein pI 10.22
Protein Weight 19563.68
Protein Length 202
Protein Note identified by similarity to EGAD:28637; match to protein family HMM PF04972
DNA Sequence
>NC_003112.2:2211862-2212470 Neisseria meningitidis MC58 chromosome, complete genome
GATGAAACCCAAACCGCACACCGTCCGCACCCTGATTGCCGCCATTTTCAGCCTTGCCCTTAGCGGCTGC
GTCAGCGCAGTAATCGGAAGCGCCGCCGTCGGCGCGAAATCCGCCGTCGACCGCCGAACCACCGGCGCGC
AAACCGACGACAACGTTATGGCGTTGCGTATCGAAACCACCGCCCGTTCCTATCTGCGCCAAAACAACCA
AACCAAAGGCTACACGCCCCAAATCTCCGTCGTCGGCTACAACCGCCACCTGCTGCTGCTCGGACAAGTC
GCCACCGAAGGCGAAAAACAGTTCGTCGGTCAGATTGCACGTTCCGAACAGGCCGCCGAAGGCGTGTACA
ACTATATTACCGTCGCCTCCCTGCCGCGCACTGCCGGCGACATCGCCGGCGACACTTGGAACACATCCAA
AGTCCGCGCCACGCTGTTGGGCATCAGCCCCGCCACACAGGCGCGCGTCAAAATCGTTACCTACGGCAAC
GTAACCTACGTTATGGGCATCCTCACCCCCGAAGAACAGGCGCAGATTACCCAAAAAGTCAGCACCACCG
TCGGCGTACAAAAAGTCATCACCCTCTACCAAAACTACGTCCAACGCTG

Protein Sequence
>NP_275079.1 hemolysin [Neisseria meningitidis MC58]
MKPKPHTVRTLIAAIFSLALSGCVSAVIGSAAVGAKSAVDRRTTGAQTDDNVMALRIETTARSYLRQNNQ
TKGYTPQISVVGYNRHLLLLGQVATEGEKQFVGQIARSEQAAEGVYNYITVASLPRTAGDIAGDTWNTSK
VRATLLGISPATQARVKIVTYGNVTYVMGILTPEEQAQITQKVSTTVGVQKVITLYQNYVQR

Molecule Role Protective antigen
Molecule Role Annotation Protective antigen as shown in some assays (Giuliani et al., 2006)
References